Psyllid ID: psy477


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60
MDSLSDKGILYLLVIKENDPEDIIHCLSQYGFMGKTLLTRQVPGEKLSVLKFTRSCDEKQ
cccccccccEEEEEEccccHHHHHHHHHHcccEEEEEEEEEcccEEEEEEEEEEcccccc
ccccccccEEEEEEEEcccHHHHHHHHHHcccccEEEEEEcccccEEEEEEEEEcccccc
mdslsdkgILYLLVIKENDPEDIIHCLSqygfmgktlltrqvpgeklSVLKFTRSCDEKQ
mdslsdkgILYLLVIKENDPEDIIHCLSQYGFMGKTLLtrqvpgeklsvlkftrscdekq
MDSLSDKGILYLLVIKENDPEDIIHCLSQYGFMGKTLLTRQVPGEKLSVLKFTRSCDEKQ
*******GILYLLVIKENDPEDIIHCLSQYGFMGKTLLTRQVPGEKLSVLKF********
MDSLSDKGILYLLVIKENDPEDIIHCLSQYGFMGKTLLTRQVPGEKLSVLK**RS*****
MDSLSDKGILYLLVIKENDPEDIIHCLSQYGFMGKTLLTRQVPGEKLSVLKFTRSCDEKQ
**SLSDKGILYLLVIKENDPEDIIHCLSQYGFMGKTLLTRQVPGEKLSVLKFTRSC****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSLSDKGILYLLVIKENDPEDIIHCLSQYGFMGKTLLTRQVPGEKLSVLKFTRSCDEKQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query60 2.2.26 [Sep-21-2011]
Q9Y5N5214 HemK methyltransferase fa no N/A 0.9 0.252 0.537 1e-09
>sp|Q9Y5N5|HEMK2_HUMAN HemK methyltransferase family member 2 OS=Homo sapiens GN=N6AMT1 PE=1 SV=3 Back     alignment and function desciption
 Score = 61.6 bits (148), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/54 (53%), Positives = 37/54 (68%)

Query: 2   DSLSDKGILYLLVIKENDPEDIIHCLSQYGFMGKTLLTRQVPGEKLSVLKFTRS 55
           D LS KG+ YL+ IKEN+PE+I+  +   G  G T L+RQ   E LSVLKFT+S
Sbjct: 161 DLLSPKGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS 214




Heterodimeric methyltransferase that catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May play a role in the modulation of arsenic-induced toxicity. May be involved in the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query60
403271691 186 PREDICTED: hemK methyltransferase family 0.9 0.290 0.537 4e-08
403271689 214 PREDICTED: hemK methyltransferase family 0.9 0.252 0.537 4e-08
313104228 214 RecName: Full=HemK methyltransferase fam 0.9 0.252 0.537 5e-08
7717305 214 PRED28 [Homo sapiens] 0.9 0.252 0.537 5e-08
334329395 219 PREDICTED: hemK methyltransferase family 0.883 0.242 0.509 6e-08
134085718 214 N(6)-adenine-specific DNA methyltransfer 0.9 0.252 0.518 7e-08
348562869 186 PREDICTED: hemK methyltransferase family 0.9 0.290 0.537 7e-08
348562867 214 PREDICTED: hemK methyltransferase family 0.9 0.252 0.537 7e-08
338720651 221 PREDICTED: hemK methyltransferase family 0.9 0.244 0.518 9e-08
402862563 210 PREDICTED: hemK methyltransferase family 0.9 0.257 0.518 1e-07
>gi|403271691|ref|XP_003927748.1| PREDICTED: hemK methyltransferase family member 2-like isoform 2 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
 Score = 62.0 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/54 (53%), Positives = 37/54 (68%)

Query: 2   DSLSDKGILYLLVIKENDPEDIIHCLSQYGFMGKTLLTRQVPGEKLSVLKFTRS 55
           D LS +G+ YL+ IKEN+PE+I+  +   G  G T L+RQ   E LSVLKFTRS
Sbjct: 133 DLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTRS 186




Source: Saimiri boliviensis boliviensis

Species: Saimiri boliviensis

Genus: Saimiri

Family: Cebidae

Order: Primates

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|403271689|ref|XP_003927747.1| PREDICTED: hemK methyltransferase family member 2-like isoform 1 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|313104228|sp|Q9Y5N5.3|HEMK2_HUMAN RecName: Full=HemK methyltransferase family member 2; AltName: Full=M.HsaHemK2P; AltName: Full=N(6)-adenine-specific DNA methyltransferase 1 Back     alignment and taxonomy information
>gi|7717305|emb|CAB90428.1| PRED28 [Homo sapiens] Back     alignment and taxonomy information
>gi|334329395|ref|XP_001373458.2| PREDICTED: hemK methyltransferase family member 2-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|134085718|ref|NP_001076982.1| N(6)-adenine-specific DNA methyltransferase 1 [Bos taurus] gi|133778119|gb|AAI23688.1| N6AMT1 protein [Bos taurus] gi|296491636|tpg|DAA33669.1| TPA: N-6 adenine-specific DNA methyltransferase 1 [Bos taurus] gi|440895318|gb|ELR47540.1| HemK methyltransferase family member 2 [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|348562869|ref|XP_003467231.1| PREDICTED: hemK methyltransferase family member 2-like isoform 2 [Cavia porcellus] Back     alignment and taxonomy information
>gi|348562867|ref|XP_003467230.1| PREDICTED: hemK methyltransferase family member 2-like isoform 1 [Cavia porcellus] Back     alignment and taxonomy information
>gi|338720651|ref|XP_001496250.3| PREDICTED: hemK methyltransferase family member 2-like [Equus caballus] Back     alignment and taxonomy information
>gi|402862563|ref|XP_003895623.1| PREDICTED: hemK methyltransferase family member 2-like [Papio anubis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query60
UNIPROTKB|Q9Y5N5214 N6AMT1 "HemK methyltransferase 0.9 0.252 0.537 6.6e-10
UNIPROTKB|A4FV35214 N6AMT1 "N6AMT1 protein" [Bos t 0.9 0.252 0.518 8.4e-10
UNIPROTKB|I3L8U770 LOC100623424 "Uncharacterized 0.866 0.742 0.519 2.2e-09
FB|FBgn0031454224 CG9960 [Drosophila melanogaste 0.883 0.236 0.471 3.9e-08
ZFIN|ZDB-GENE-040718-206219 n6amt1 "N-6 adenine-specific D 0.983 0.269 0.389 4.7e-08
RGD|1311843214 N6amt1 "N-6 adenine-specific D 0.866 0.242 0.480 7.2e-08
UNIPROTKB|E1C233217 N6AMT1 "Uncharacterized protei 0.883 0.244 0.433 1e-07
DICTYBASE|DDB_G0292048257 DDB_G0292048 "N(6)-adenine-spe 0.85 0.198 0.392 1.5e-05
CGD|CAL0004742224 orf19.331 [Candida albicans (t 0.85 0.227 0.372 0.00084
UNIPROTKB|Q9Y5N5 N6AMT1 "HemK methyltransferase family member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 142 (55.0 bits), Expect = 6.6e-10, P = 6.6e-10
 Identities = 29/54 (53%), Positives = 37/54 (68%)

Query:     2 DSLSDKGILYLLVIKENDPEDIIHCLSQYGFMGKTLLTRQVPGEKLSVLKFTRS 55
             D LS KG+ YL+ IKEN+PE+I+  +   G  G T L+RQ   E LSVLKFT+S
Sbjct:   161 DLLSPKGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS 214




GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0008276 "protein methyltransferase activity" evidence=IDA
GO:0030307 "positive regulation of cell growth" evidence=IDA
GO:0043234 "protein complex" evidence=IDA
GO:0006479 "protein methylation" evidence=IDA
UNIPROTKB|A4FV35 N6AMT1 "N6AMT1 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3L8U7 LOC100623424 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0031454 CG9960 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-206 n6amt1 "N-6 adenine-specific DNA methyltransferase 1 (putative)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1311843 N6amt1 "N-6 adenine-specific DNA methyltransferase 1 (putative)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C233 N6AMT1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0292048 DDB_G0292048 "N(6)-adenine-specific DNA methyltransferase 1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
CGD|CAL0004742 orf19.331 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 60
KOG3191|consensus209 99.7
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 98.66
PRK14968188 putative methyltransferase; Provisional 97.66
PRK14967223 putative methyltransferase; Provisional 96.78
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 96.02
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 94.7
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 94.41
COG2890280 HemK Methylase of polypeptide chain release factor 93.57
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 93.29
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 92.4
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 92.33
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 90.38
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 90.35
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 90.22
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 89.59
PRK07402196 precorrin-6B methylase; Provisional 89.27
TIGR00438188 rrmJ cell division protein FtsJ. 88.66
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 87.62
COG4123248 Predicted O-methyltransferase [General function pr 87.49
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 83.82
PLN02233261 ubiquinone biosynthesis methyltransferase 83.51
KOG3045|consensus325 82.88
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 82.54
KOG0862|consensus216 81.68
KOG1271|consensus227 80.31
>KOG3191|consensus Back     alignment and domain information
Probab=99.70  E-value=3.8e-17  Score=108.74  Aligned_cols=54  Identities=41%  Similarity=0.767  Sum_probs=52.4

Q ss_pred             ceecCCCeEEEEEeccCCHHHHHHHHhhCCceEEEEEEEeeCCeEEEEEEEEeC
Q psy477            2 DSLSDKGILYLLVIKENDPEDIIHCLSQYGFMGKTLLTRQVPGEKLSVLKFTRS   55 (60)
Q Consensus         2 ~~Ls~~G~~YLv~~~~N~p~ei~~~~~~~G~~~~vv~~rk~~~E~L~Vlr~~r~   55 (60)
                      ++|||+|+||||++..|+|+||++.|++.||.+.++.+||+++|+|+|+||+|+
T Consensus       156 ~iLSp~Gv~Ylv~~~~N~p~ei~k~l~~~g~~~~~~~~Rk~~~E~l~ilkf~r~  209 (209)
T KOG3191|consen  156 DILSPRGVFYLVALRANKPKEILKILEKKGYGVRIAMQRKAGGETLSILKFTRS  209 (209)
T ss_pred             hhcCcCceEEeeehhhcCHHHHHHHHhhcccceeEEEEEecCCceEEEEEEEeC
Confidence            589999999999999999999999999999999999999999999999999984



>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>KOG3045|consensus Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG0862|consensus Back     alignment and domain information
>KOG1271|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query60
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 6e-13
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Length = 170 Back     alignment and structure
 Score = 58.3 bits (141), Expect = 6e-13
 Identities = 17/50 (34%), Positives = 32/50 (64%)

Query: 6   DKGILYLLVIKENDPEDIIHCLSQYGFMGKTLLTRQVPGEKLSVLKFTRS 55
             G+LYLLVI+ N P++++  L + G+  + L  R++ GE + ++K  +S
Sbjct: 115 TVGMLYLLVIEANRPKEVLARLEERGYGTRILKVRKILGETVYIIKGEKS 164


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query60
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.32
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 97.79
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 96.0
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 95.83
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 95.62
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 95.58
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 94.72
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 94.45
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 94.45
3lcc_A235 Putative methyl chloride transferase; halide methy 94.25
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 94.18
3lpm_A259 Putative methyltransferase; structural genomics, p 94.11
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 93.95
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 93.86
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 93.69
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 93.64
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 93.59
1yb2_A275 Hypothetical protein TA0852; structural genomics, 92.5
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 92.48
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 92.39
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 91.92
2frn_A278 Hypothetical protein PH0793; structural genomics, 91.9
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 91.76
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 91.74
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 91.62
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 90.66
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 90.61
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 90.53
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 90.52
3i9f_A170 Putative type 11 methyltransferase; structural gen 90.46
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 90.06
2i62_A265 Nicotinamide N-methyltransferase; structural genom 89.99
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 89.66
1vlm_A219 SAM-dependent methyltransferase; possible histamin 89.54
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 89.41
3dh0_A219 SAM dependent methyltransferase; cystal structure, 89.24
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 89.23
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 89.08
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 89.01
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 88.98
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 88.84
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 88.75
2fpo_A202 Methylase YHHF; structural genomics, putative meth 88.58
3hnr_A220 Probable methyltransferase BT9727_4108; structural 88.51
2p7i_A250 Hypothetical protein; putative methyltransferase, 88.31
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 87.19
2b3t_A276 Protein methyltransferase HEMK; translation termin 86.91
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 86.52
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 86.21
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 85.96
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 85.66
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 85.31
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 84.97
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 84.83
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 84.81
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 84.39
1jsx_A207 Glucose-inhibited division protein B; methyltransf 84.33
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 84.33
2esr_A177 Methyltransferase; structural genomics, hypothetic 83.81
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 83.59
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 83.03
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 82.47
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 82.45
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 82.2
3f4k_A257 Putative methyltransferase; structural genomics, P 81.54
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 81.46
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 81.14
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 80.8
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 80.46
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 80.41
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 80.06
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
Probab=98.32  E-value=4.8e-06  Score=50.71  Aligned_cols=51  Identities=33%  Similarity=0.612  Sum_probs=48.3

Q ss_pred             CCCeEEEEEeccCCHHHHHHHHhhCCceEEEEEEEeeCCeEEEEEEEEeCC
Q psy477            6 DKGILYLLVIKENDPEDIIHCLSQYGFMGKTLLTRQVPGEKLSVLKFTRSC   56 (60)
Q Consensus         6 ~~G~~YLv~~~~N~p~ei~~~~~~~G~~~~vv~~rk~~~E~L~Vlr~~r~~   56 (60)
                      |+|.++++....+.++++.+.+++.||....+.+++.++|++++++.+++-
T Consensus       115 pgG~l~~~~~~~~~~~~l~~~l~~~gf~~~~~~~~~~~~e~~~~~~~~~~~  165 (170)
T 3q87_B          115 TVGMLYLLVIEANRPKEVLARLEERGYGTRILKVRKILGETVYIIKGEKSH  165 (170)
T ss_dssp             CSSEEEEEEEGGGCHHHHHHHHHHTTCEEEEEEEEECSSSEEEEEEEECC-
T ss_pred             CCCEEEEEEecCCCHHHHHHHHHHCCCcEEEEEeeccCCceEEEEEEeccc
Confidence            999999999999999999999999999999999999999999999999863



>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query60
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 92.93
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 92.77
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 90.61
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 90.34
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 87.62
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 86.89
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 85.33
d1clia2175 Aminoimidazole ribonucleotide synthetase (PurM) C- 83.47
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 80.54
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 80.1
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 80.02
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Hypothetical protein MJ0882
domain: Hypothetical protein MJ0882
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
Probab=92.93  E-value=0.021  Score=33.72  Aligned_cols=39  Identities=10%  Similarity=0.216  Sum_probs=28.8

Q ss_pred             ceecCCCeEEEEEeccCCHHHHHHHHhhCCceEEEEEEE
Q psy477            2 DSLSDKGILYLLVIKENDPEDIIHCLSQYGFMGKTLLTR   40 (60)
Q Consensus         2 ~~Ls~~G~~YLv~~~~N~p~ei~~~~~~~G~~~~vv~~r   40 (60)
                      +.|+|+|.+|++.......+.+.+.+++....++.+.+.
T Consensus       145 ~~LkpgG~l~i~~~~~~~~~~~~~~l~~~f~~~~~~~~~  183 (194)
T d1dusa_         145 ELLKDNGEIWVVIQTKQGAKSLAKYMKDVFGNVETVTIK  183 (194)
T ss_dssp             HHEEEEEEEEEEEESTHHHHHHHHHHHHHHSCCEEEEEE
T ss_pred             HhcCcCcEEEEEEeCcCCHHHHHHHHHHhCCcEEEEEec
Confidence            578999999998887777777777777755556655443



>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1clia2 d.139.1.1 (A:171-345) Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure