Diaphorina citri psyllid: psy4780


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MGENVVYTYVSVGEFWAFVIGWNIILEHMIGKHMVCKHMIGAASVARAWSGYVDSLCGGAISNFTIATVGELHEDLLGKYPDFLAFFVCLGYALLLGAASVARAWSGYVDSLCGGAISNFTIATVGELHEDLLGKYPDFLAFFVCLGYALLLGKKI
ccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccc
*GENVVYTYVSVGEFWAFVIGWNIILEHMIGKHMVCKHMIGAASVARAWSGYVDSLCGGAISNFTIATVGELHEDLLGKYPDFLAFFVCLGYALLLGAASVARAWSGYVDSLCGGAISNFTIATVGELHEDLLGKYPDFLAFFVCLGYALLLGKKI
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGENVVYTYVSVGEFWAFVIGWNIILEHMIGKHMVCKHMIGAASVARAWSGYVDSLCGGAISNFTIATVGELHEDLLGKYPDFLAFFVCLGYALLLGAASVARAWSGYVDSLCGGAISNFTIATVGELHEDLLGKYPDFLAFFVCLGYALLLGKKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cationic amino acid transporter 4 Involved in the transport of the cationic amino acids (arginine, lysine and ornithine).confidentO43246

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0015802 [BP]basic amino acid transportprobableGO:0006810, GO:0044765, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0006812 [BP]cation transportprobableGO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0015181 [MF]arginine transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0008324, GO:0015075, GO:0022857, GO:0003674, GO:0015174, GO:0015171, GO:0046943

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:confident
Coverage over the Query: 1-30,41-65,81-127
View the alignment between query and template
View the model in PyMOL