Diaphorina citri psyllid: psy4798

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620---
MEFTLEFQIFYGIIGFSWIVFLFEFYLSIRQRRVYHETTIVPHQIAHGMDAESFEKSRRYSLDKNVFSMFKETVSNVMNTVSSKRSEHSNAYFYGFFKNKRIVLFDTLLKDYVPLNADKKDKSGDSEPLISTEGANKKGCDTEEVLAVLAHELGHWKYNHVLKSMIVMQLNLLFMLYSFQYLFQYPPLYSAFGFYDSQPILLGLIIVLQYVFAPYNQLVQFLMTCMTRRFEFQADAFGKSLGKAIFLRKALLKINKDNLGFPALLVCNGLPYFWSKSEELGETYFGFHKNEIVTSCLFIVLFNIFSTVIGLPISFYHHFVLEEKHGFNKQTYGFFVKDQIKSFIVSLILSIPLTGAVVYIIQTYGFFVKDQIKSFIVSLILSIPLTGAVVYIIQVGGNMVFLYLWVFIILMSLFLMTIYPEFIAPLFDKYTPLPDGELKSRIEQLSASVKFPLKKLYVVEGSKRSEHSNAYFYGFFKNKRIVLFDTLLKDYVPLNADKKDKAGDSEPLISTEGANKKGCDTEEVLAVLAHELGHWKYNHVLKSMILKKEFGVANKEREASVMRYVTKESELITARQDREAAEKKYKEAMKEKDNVMAKLKVLSTDKARLTQLYDDKVRMYNVR
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHcccccccEEEEEcccccccccEEEEccccccEEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcccccccEEEEEcccccccccEEEEcccccEEEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
*EFTLEFQIFYGIIGFSWIVFLFEFYLSIRQRRVYHETTIVPHQIAHGMDAESFEKSRRYSLDKNVFSMFKETVSNVMNTVSSKRSEHSNAYFYGFFKNKRIVLFDTLLKDYV**************************CDTEEVLAVLAHELGHWKYNHVLKSMIVMQLNLLFMLYSFQYLFQYPPLYSAFGFYDSQPILLGLIIVLQYVFAPYNQLVQFLMTCMTRRFEFQADAFGKSLGKAIFLRKALLKINKDNLGFPALLVCNGLPYFWSKSEELGETYFGFHKNEIVTSCLFIVLFNIFSTVIGLPISFYHHFVLEEKHGFNKQTYGFFVKDQIKSFIVSLILSIPLTGAVVYIIQTYGFFVKDQIKSFIVSLILSIPLTGAVVYIIQVGGNMVFLYLWVFIILMSLFLMTIYPEFIAPLFDKYTPLPDGELKSRIEQLSASVKFPLKKLYVVEGSKRSEHSNAYFYGFFKNKRIVLFDTLLKDYV**************************CDTEEVLAVLAHELGHWKYNHVLKSMILKKEFGVANKEREASVMRYVTKESELITARQDREAAEKKYKEAMKEKDNVMAKLKVLSTDKARLTQLYDDKVRMY***
xxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFTLEFQIFYGIIGFSWIVFLFEFYLSIRQRRVYHETTIVPHQIAHGMDAESFEKSRRYSLDKNVFSMFKETVSNVMNTVSSKRSEHSNAYFYGFFKNKRIVLFDTLLKDYVPLNADKKDKSGDSEPLISTEGANKKGCDTEEVLAVLAHELGHWKYNHVLKSMIVMQLNLLFMLYSFQYLFQYPPLYSAFGFYDSQPILLGLIIVLQYVFAPYNQLVQFLMTCMTRRFEFQADAFGKSLGKAIFLRKALLKINKDNLGFPALLVCNGLPYFWSKSEELGETYFGFHKNEIVTSCLFIVLFNIFSTVIGLPISFYHHFVLEEKHGFNKQTYGFFVKDQIKSFIVSLILSIPLTGAVVYIIQTYGFFVKDQIKSFIVSLILSIPLTGAVVYIIQVGGNMVFLYLWVFIILMSLFLMTIYPEFIAPLFDKYTPLPDGELKSRIEQLSASVKFPLKKLYVVEGSKRSEHSNAYFYGFFKNKRIVLFDTLLKDYVPLNADKKDKAGDSEPLISTEGANKKGCDTEEVLAVLAHELGHWKYNHVLKSMILKKEFGVANKEREASVMRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKARLTQLYDDKVRMYNVR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071586 [BP]CAAX-box protein processingprobableGO:0044267, GO:0044260, GO:0051604, GO:0044238, GO:0019538, GO:0009987, GO:0080120, GO:0044237, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152, GO:0016485

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AW6, chain A
Confidence level:very confident
Coverage over the Query: 4-77,212-214,263-347,380-489,517-622
View the alignment between query and template
View the model in PyMOL
Template: 4AW6, chain A
Confidence level:very confident
Coverage over the Query: 37-63,82-110,138-263
View the alignment between query and template
View the model in PyMOL
Template: 4IL3, chain A
Confidence level:confident
Coverage over the Query: 271-370,400-488,517-548
View the alignment between query and template
View the model in PyMOL