Diaphorina citri psyllid: psy4828


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
MSKSNVNNVNMKEMIPNLPDDKTDMIAATSVLQQQATEVRNQRPNWNTYQQSQMISKEDYDFITVFDTASSAKRAEMLNERRGHAAKTFLNLLEHISKDSTIQYILVLIDDILQEDRSRVEIFKEYSQTKREPVCSQFLNLLNGSDGFIINMTAKIIAKIACWSVDLLNPSDLNFYLTWLKDQLKLANNDYMQSVARCLQMMLRIDEYRIAFINVDGIRTLLSVLSGRVNFQIQYQLIFCLWVLTFNPKLADRMNKFNVIPTLADILSDSVKEKNLIEKPTEPALAKENCIAMVQSKVLKQLSILEQRKFDDEDIVEDVQFLNEKLQASVQDLSSFDEYKTEVKSGRLEWSPVHRSAQFWRENAPRLHEKNYELLKSLIHLLETSRDPLVLSVASYDIGEYVRHCPRGKHVIEQLGGKQLVMQLLSHEDPNVRYEALLAVQKLMVHNW
ccccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHccccccHHHHHHHHHHHHHHHHEEEccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHcHHHHHHHcHHHHHHHHHHHccccccccHHHHHcHHHHHHHHccccHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHccc
******************PDDKTDMIAATSVLQQQATEVRNQRPNWNTYQQSQMISKEDYDFITVFDTA*************GHAAKTFLNLLEHISKDSTIQYILVLIDDILQEDRSRVEIFKEYSQTKREPVCSQFLNLLNGSDGFIINMTAKIIAKIACWSVDLLNPSDLNFYLTWLKDQLKLANNDYMQSVARCLQMMLRIDEYRIAFINVDGIRTLLSVLSGRVNFQIQYQLIFCLWVLTFNPKLADRMNKFNVIPTLADILSDSVKEKNLIEKPTEPALAKENCIAMVQSKVLKQLSILEQRKFDDEDIVEDVQFLNEKLQASVQDLSSFDEYKTEVKSGRLEWSPVHRSAQFWRENAPRLHEKNYELLKSLIHLLETSRDPLVLSVASYDIGEYVRHCPRGKHVIEQLGGKQLVMQLLSHEDPNVRYEALLAVQKLMVHNW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKSNVNNVNMKEMIPNLPDDKTDMIAATSVLQQQATEVRNQRPNWNTYQQSQMISKEDYDFITVFDTASSAKRAEMLNERRGHAAKTFLNLLEHISKDSTIQYILVLIDDILQEDRSRVEIFKEYSQTKREPVCSQFLNLLNGSDGFIINMTAKIIAKIACWSVDLLNPSDLNFYLTWLKDQLKLANNDYMQSVARCLQMMLRIDEYRIAFINVDGIRTLLSVLSGRVNFQIQYQLIFCLWVLTFNPKLADRMNKFNVIPTLADILSDSVKEKNLIEKPTEPALAKENCIAMVQSKVLKQLSILEQRKFDDEDIVEDVQFLNEKLQASVQDLSSFDEYKTEVKSGRLEWSPVHRSAQFWRENAPRLHEKNYELLKSLIHLLETSRDPLVLSVASYDIGEYVRHCPRGKHVIEQLGGKQLVMQLLSHEDPNVRYEALLAVQKLMVHNW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
V-type proton ATPase subunit H Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit H activates the ATPase activity of the enzyme and couples ATPase activity to proton flow. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. Involved in the endocytosis mediated by clathrin-coated pits, required for the formation of endosomes.very confidentO46563
V-type proton ATPase subunit H Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit H activates the ATPase activity of the enzyme and couples ATPase activity to proton flow. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. Involved in the endocytosis mediated by clathrin-coated pits, required for the formation of endosomes.very confidentQ9TVC1
V-type proton ATPase subunit H Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit H activates the ATPase activity of the enzyme and couples ATPase activity to proton flow. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system (By similarity). Involved in the endocytosis mediated by clathrin-coated pits, required for the formation of endosomes.very confidentQ9UI12

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005886 [CC]plasma membraneconfidentGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0015991 [BP]ATP hydrolysis coupled proton transportprobableGO:0006818, GO:0015992, GO:0006812, GO:0006811, GO:0006810, GO:0015988, GO:0015672, GO:0034220, GO:0044765, GO:0044763, GO:0051179, GO:0008150, GO:0009987, GO:0051234, GO:0055085, GO:0044699
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0046961 [MF]proton-transporting ATPase activity, rotational mechanismprobableGO:0003674, GO:0016887, GO:0042625, GO:0042626, GO:0016820, GO:0042623, GO:0015077, GO:0015399, GO:0022804, GO:0016787, GO:0005215, GO:0008324, GO:0017111, GO:0003824, GO:0044769, GO:0022891, GO:0022890, GO:0016818, GO:0022892, GO:0043492, GO:0016817, GO:0019829, GO:0015075, GO:0016462, GO:0022857, GO:0015078, GO:0015405
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0033181 [CC]plasma membrane proton-transporting V-type ATPase complexprobableGO:0043234, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0016469, GO:0044459, GO:0033176
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0043652 [BP]engulfment of apoptotic cellprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0006911, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0043277, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0033227 [BP]dsRNA transportprobableGO:0015931, GO:0050658, GO:0051234, GO:0006810, GO:0050657, GO:0071705, GO:0044765, GO:0008150, GO:0071702, GO:0033036, GO:0051236, GO:0006403, GO:0051179, GO:0044699
GO:0018996 [BP]molting cycle, collagen and cuticulin-based cuticleprobableGO:0008150, GO:0032501, GO:0042303, GO:0044699, GO:0044707
GO:0000221 [CC]vacuolar proton-transporting V-type ATPase, V1 domainprobableGO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0005773, GO:0016020, GO:0005774, GO:0033180, GO:0044437, GO:0016471, GO:0043231, GO:0043234, GO:0032991, GO:0005575, GO:0044464, GO:0005623, GO:0005622, GO:0033178, GO:0044444, GO:0033176, GO:0044424, GO:0044425, GO:0016469, GO:0044422
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0040002 [BP]collagen and cuticulin-based cuticle developmentprobableGO:0032502, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699
GO:0040007 [BP]growthprobableGO:0008150
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0008553 [MF]hydrogen-exporting ATPase activity, phosphorylative mechanismprobableGO:0003674, GO:0016887, GO:0042625, GO:0042626, GO:0016820, GO:0042623, GO:0015077, GO:0015399, GO:0022804, GO:0016787, GO:0005215, GO:0008324, GO:0017111, GO:0003824, GO:0022891, GO:0022890, GO:0016818, GO:0022892, GO:0043492, GO:0016817, GO:0019829, GO:0015075, GO:0016462, GO:0022857, GO:0015078, GO:0015662, GO:0015405
GO:0007035 [BP]vacuolar acidificationprobableGO:0019725, GO:0042592, GO:0044699, GO:0045851, GO:0008150, GO:0006885, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0055080, GO:0030004, GO:0065007, GO:0044763, GO:0055067, GO:0030003, GO:0051453, GO:0051452, GO:0055082, GO:0065008, GO:0030641
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0000325 [CC]plant-type vacuoleprobableGO:0005737, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HO8, chain A
Confidence level:very confident
Coverage over the Query: 23-448
View the alignment between query and template
View the model in PyMOL