Diaphorina citri psyllid: psy4837


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MITTHRYLLTLHVYPGETALAFYTAKNPTNSPIVGISTYNVVPFDAGQYFNKIQCFCFEEQQLNPHEELQIFAPKKPHHNEHKMRSQILPKVEIANVSSN
cEEEEEEccEEEEEccccEEEEEEECccccccEEEEEEcccccccHHcccCEcEEEEEEccccccccEEEEEccccccccccccccEEEEEEEEEEEccc
MITTHRYLLTLHVYPGETALAFYTAKNPTNSPIVGISTYNVVPFDAGQYFNKIQCFCFEEQQLNPHEELQIFAPKKPHHNEHKMRSQILPKVEIANV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MITTHRYLLTLHVYPGETALAFYTAKNPTNSPIVGISTYNVVPFDAGQYFNKIQCFCFEEQQLNPHEELQIFAPKKPHHNEHKMRSQILPKVEIANVSSN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome c oxidase assembly protein COX11, mitochondrial Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I.confidentQ5R7U6
Cytochrome c oxidase assembly protein COX11, mitochondrial Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I.confidentQ9Y6N1
Cytochrome c oxidase assembly protein COX11, mitochondrial Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I.confidentQ6P8I6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0004129 [MF]cytochrome-c oxidase activityprobableGO:0022891, GO:0022890, GO:0022892, GO:0005215, GO:0008324, GO:0022857, GO:0015075, GO:0003824, GO:0015077, GO:0016676, GO:0016675, GO:0003674, GO:0015078, GO:0015002, GO:0016491
GO:0007585 [BP]respiratory gaseous exchangeprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0031304 [CC]intrinsic to mitochondrial inner membraneprobableGO:0044464, GO:0031975, GO:0043229, GO:0031300, GO:0043227, GO:0043226, GO:0031224, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043231, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0044429, GO:0044424, GO:0044425, GO:0044422
GO:0005507 [MF]copper ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0008535 [BP]respiratory chain complex IV assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0034622, GO:0043623, GO:0071840
GO:0005758 [CC]mitochondrial intermembrane spaceprobableGO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0009055 [MF]electron carrier activityprobableGO:0003674
GO:0005761 [CC]mitochondrial ribosomeprobableGO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0030529, GO:0005759, GO:0000313, GO:0043231, GO:0032991, GO:0005840, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SO9, chain A
Confidence level:very confident
Coverage over the Query: 3-89
View the alignment between query and template
View the model in PyMOL