Diaphorina citri psyllid: psy4846

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28

MDNAMLRRHPVPPPANFEPLLHAARRQGFELSVGTGKELATSLDAAAVYFSSGMLQQSDFHHYGLATPIYTHFTSPIRRYADIIVHRLLAACIGADATYPSLLDKKASTALCYNLNYRNRQAQYAGRASVALHTHLFFRSRVQDEDGYVLYVRKNALQILIPKSRVQDEDGYVLYVRKNALQILIPKYGLEGTLFLRCDSPSVSWTYNEKEQSQSCGSVVFHSFDPVTVQLSLDRSNVQHEKLVLRLVRPVIEGFSVSSAGEQGEEKMEEGETRSLYCD

ccccEEEcccccccccHHHHHHHHHHcccEEEcccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEccEEEECccccccccccEEEEEEEccEEEEEcccccccEEEEcccccccEEEEcccccccccccEEEEEccCEEEEEEEEccccccccEEEEEEccccccccccccccccccccccccccccccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005654 [CC]	nucleoplasm	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005652 [CC]	nuclear lamina	probable	GO:0034399, GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000176 [CC]	nuclear exosome (RNase complex)	probable	GO:0043234, GO:0005575, GO:0000178, GO:0032991, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005085 [MF]	guanyl-nucleotide exchange factor activity	probable	GO:0030695, GO:0030234, GO:0060589, GO:0003674
GO:0004540 [MF]	ribonuclease activity	probable	GO:0004518, GO:0016787, GO:0003674, GO:0016788, GO:0003824
GO:0006401 [BP]	RNA catabolic process	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0044238, GO:0044270, GO:0044237, GO:0043170, GO:0019439

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WP8, chain J
Confidence level:very confident
Coverage over the Query: 2-150,175-248
View the alignment between query and template
View the model in PyMOL

Template: 3GO5, chain A
Confidence level:probable
Coverage over the Query: 167-200,218-269
View the alignment between query and template
View the model in PyMOL