Diaphorina citri psyllid: psy4850


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60----
MVDLVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK
cccccccccccccHHHHHHHHHHHHcccccccccEEEcccEEEEcccccccHHHHHHHHHcccc
*******EFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDLVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Metal transporter CNNM2 Divalent metal cation transporter. Mediates transport of divalent metal cations in an order of Mg(2+) > Co(2+) > Mn(2+) > Sr(2+) > Ba(2+) > Cu(2+) > Fe(2+).confidentQ3TWN3
Metal transporter CNNM4 Probable metal transporter. The interaction with the metal ion chaperone COX11 suggests that it may play a role in sensory neuron functions. May play a role in biomineralization and retinal function.confidentP0C588
Metal transporter CNNM4 Probable metal transporter. The interaction with the metal ion chaperone COX11 suggests that it may play a role in sensory neuron functions (By similarity). May play a role in biomineralization and retinal function.confidentQ6P4Q7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050801 [BP]ion homeostasisprobableGO:0042592, GO:0008150, GO:0065008, GO:0065007, GO:0048878
GO:0015693 [BP]magnesium ion transportprobableGO:0072511, GO:0006812, GO:0006811, GO:0006810, GO:0008150, GO:0044765, GO:0030001, GO:0070838, GO:0051234, GO:0051179, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OI8, chain A
Confidence level:confident
Coverage over the Query: 6-64
View the alignment between query and template
View the model in PyMOL