Psyllid ID: psy4850


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60----
MVDLVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK
cccccccccccccHHHHHHHHHHHHcccccccccEEEcccEEEEcccccccHHHHHHHHHcccc
cccccccccccccHHHHHHHHHHHHHHcccHHHHccccHcEEEEccccEccHHHHHHHHHHccc
MVDLVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK
MVDLVTtefndlekdevniisgalelrrKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK
MVDLVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK
*******EFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVS********
**********DLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKS***
MVDLVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVS********
*VDLVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKS***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDLVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query64 2.2.26 [Sep-21-2011]
Q6P4Q7 775 Metal transporter CNNM4 O yes N/A 0.890 0.073 0.614 3e-13
P0C588 772 Metal transporter CNNM4 O yes N/A 0.890 0.073 0.614 4e-13
Q3TWN3 875 Metal transporter CNNM2 O yes N/A 0.890 0.065 0.631 4e-13
Q69ZF7 771 Metal transporter CNNM4 O no N/A 0.890 0.073 0.614 4e-13
Q5U2P1 875 Metal transporter CNNM2 O no N/A 0.890 0.065 0.631 4e-13
Q9H8M5 875 Metal transporter CNNM2 O no N/A 0.890 0.065 0.631 5e-13
Q0GA42 951 Metal transporter CNNM1 O no N/A 0.828 0.055 0.603 5e-12
Q9NRU3 951 Metal transporter CNNM1 O no N/A 0.828 0.055 0.603 5e-12
A0JPA0 769 Metal transporter CNNM4 O no N/A 0.890 0.074 0.578 9e-12
Q12296 706 Protein MAM3 OS=Saccharom yes N/A 0.781 0.070 0.5 4e-06
>sp|Q6P4Q7|CNNM4_HUMAN Metal transporter CNNM4 OS=Homo sapiens GN=CNNM4 PE=1 SV=3 Back     alignment and function desciption
 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 46/57 (80%)

Query: 5   VTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKS 61
           VT  +NDL K+E+N+I GALELR K V D+MT+L+D +M+  DAILDF T+SEIM+S
Sbjct: 347 VTEPYNDLVKEELNMIQGALELRTKTVEDIMTQLQDCFMIRSDAILDFNTMSEIMES 403




Probable metal transporter. The interaction with the metal ion chaperone COX11 suggests that it may play a role in sensory neuron functions (By similarity). May play a role in biomineralization and retinal function.
Homo sapiens (taxid: 9606)
>sp|P0C588|CNNM4_RAT Metal transporter CNNM4 OS=Rattus norvegicus GN=Cnnm4 PE=1 SV=1 Back     alignment and function description
>sp|Q3TWN3|CNNM2_MOUSE Metal transporter CNNM2 OS=Mus musculus GN=Cnnm2 PE=1 SV=3 Back     alignment and function description
>sp|Q69ZF7|CNNM4_MOUSE Metal transporter CNNM4 OS=Mus musculus GN=Cnnm4 PE=1 SV=2 Back     alignment and function description
>sp|Q5U2P1|CNNM2_RAT Metal transporter CNNM2 OS=Rattus norvegicus GN=Cnnm2 PE=2 SV=1 Back     alignment and function description
>sp|Q9H8M5|CNNM2_HUMAN Metal transporter CNNM2 OS=Homo sapiens GN=CNNM2 PE=1 SV=2 Back     alignment and function description
>sp|Q0GA42|CNNM1_MOUSE Metal transporter CNNM1 OS=Mus musculus GN=Cnnm1 PE=1 SV=5 Back     alignment and function description
>sp|Q9NRU3|CNNM1_HUMAN Metal transporter CNNM1 OS=Homo sapiens GN=CNNM1 PE=2 SV=3 Back     alignment and function description
>sp|A0JPA0|CNNM4_XENTR Metal transporter CNNM4 OS=Xenopus tropicalis GN=cnnm4 PE=2 SV=1 Back     alignment and function description
>sp|Q12296|MAM3_YEAST Protein MAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAM3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query64
328720335 986 PREDICTED: metal transporter CNNM2-like 0.953 0.061 0.836 3e-20
328720337 950 PREDICTED: metal transporter CNNM2-like 0.953 0.064 0.836 3e-20
328720333 931 PREDICTED: metal transporter CNNM2-like 0.953 0.065 0.836 3e-20
307209414 1012 Metal transporter CNNM2 [Harpegnathos sa 0.890 0.056 0.824 5e-20
383860842 944 PREDICTED: metal transporter CNNM2-like 0.890 0.060 0.859 9e-20
307177469 1003 Metal transporter CNNM2 [Camponotus flor 0.890 0.056 0.824 2e-19
332022207 999 Metal transporter CNNM2 [Acromyrmex echi 0.890 0.057 0.842 2e-19
328783660 945 PREDICTED: metal transporter CNNM2-like 0.890 0.060 0.842 3e-19
380016390 985 PREDICTED: LOW QUALITY PROTEIN: metal tr 0.890 0.057 0.842 3e-19
350403868 950 PREDICTED: metal transporter CNNM2-like 0.890 0.06 0.842 5e-19
>gi|328720335|ref|XP_001945496.2| PREDICTED: metal transporter CNNM2-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 51/61 (83%), Positives = 54/61 (88%)

Query: 1   MVDLVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMK 60
           +V +   E+NDLEKDEVNIISGALEL RK VGDVMTKLEDVYMLSYD ILDFETVSEIMK
Sbjct: 500 LVKMTGDEYNDLEKDEVNIISGALELHRKKVGDVMTKLEDVYMLSYDTILDFETVSEIMK 559

Query: 61  S 61
           S
Sbjct: 560 S 560




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328720337|ref|XP_003247005.1| PREDICTED: metal transporter CNNM2-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328720333|ref|XP_003247004.1| PREDICTED: metal transporter CNNM2-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307209414|gb|EFN86431.1| Metal transporter CNNM2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383860842|ref|XP_003705897.1| PREDICTED: metal transporter CNNM2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307177469|gb|EFN66596.1| Metal transporter CNNM2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332022207|gb|EGI62522.1| Metal transporter CNNM2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328783660|ref|XP_625178.3| PREDICTED: metal transporter CNNM2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380016390|ref|XP_003692168.1| PREDICTED: LOW QUALITY PROTEIN: metal transporter CNNM2-like [Apis florea] Back     alignment and taxonomy information
>gi|350403868|ref|XP_003486930.1| PREDICTED: metal transporter CNNM2-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query64
FB|FBgn0262124 834 uex "unextended" [Drosophila m 0.890 0.068 0.719 2.3e-15
ZFIN|ZDB-GENE-050208-36 811 cnnm2a "cyclin M2a" [Danio rer 0.890 0.070 0.666 8.3e-13
UNIPROTKB|Q6P4Q7 775 CNNM4 "Metal transporter CNNM4 0.890 0.073 0.614 1.6e-12
UNIPROTKB|F1ND49 598 CNNM2 "Uncharacterized protein 0.890 0.095 0.614 2.3e-12
MGI|MGI:2151060 771 Cnnm4 "cyclin M4" [Mus musculu 0.890 0.073 0.614 2.6e-12
RGD|1305571 772 Cnnm4 "cyclin M4" [Rattus norv 0.890 0.073 0.614 2.6e-12
UNIPROTKB|F1S849 827 CNNM2 "Uncharacterized protein 0.890 0.068 0.631 3.7e-12
UNIPROTKB|E1BIL3 853 CNNM2 "Uncharacterized protein 0.890 0.066 0.631 3.9e-12
UNIPROTKB|E2RJ19 875 CNNM2 "Uncharacterized protein 0.890 0.065 0.631 4e-12
UNIPROTKB|Q9H8M5 875 CNNM2 "Metal transporter CNNM2 0.890 0.065 0.631 4e-12
FB|FBgn0262124 uex "unextended" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 205 (77.2 bits), Expect = 2.3e-15, P = 2.3e-15
 Identities = 41/57 (71%), Positives = 48/57 (84%)

Query:     5 VTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKS 61
             VT + NDL+K+EVNIISGALELR+K V DVMT + D +MLS DA+LDFETVSEIM S
Sbjct:   350 VTNDVNDLDKNEVNIISGALELRKKTVADVMTHINDAFMLSLDALLDFETVSEIMNS 406




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0006873 "cellular ion homeostasis" evidence=ISS
ZFIN|ZDB-GENE-050208-36 cnnm2a "cyclin M2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P4Q7 CNNM4 "Metal transporter CNNM4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1ND49 CNNM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2151060 Cnnm4 "cyclin M4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305571 Cnnm4 "cyclin M4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S849 CNNM2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BIL3 CNNM2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RJ19 CNNM2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H8M5 CNNM2 "Metal transporter CNNM2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6P4Q7CNNM4_HUMANNo assigned EC number0.61400.89060.0735yesN/A
Q3TWN3CNNM2_MOUSENo assigned EC number0.63150.89060.0651yesN/A
P0C588CNNM4_RATNo assigned EC number0.61400.89060.0738yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query64
COG1253 429 COG1253, TlyC, Hemolysins and related proteins con 3e-04
>gnl|CDD|224173 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
 Score = 36.1 bits (84), Expect = 3e-04
 Identities = 11/40 (27%), Positives = 22/40 (55%)

Query: 12  LEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILD 51
           LE++E  +I+  L+L  + V ++MT   D+  L     ++
Sbjct: 189 LEEEEREMINNVLDLDDRTVREIMTPRTDIVALDLTDTVE 228


Length = 429

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 64
COG1253 429 TlyC Hemolysins and related proteins containing CB 99.53
PRK11573 413 hypothetical protein; Provisional 99.52
TIGR03520 408 GldE gliding motility-associated protein GldE. Mem 99.47
PRK15094 292 magnesium/cobalt efflux protein CorC; Provisional 99.42
COG4535 293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 99.35
COG4536 423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 99.13
KOG2118|consensus 498 98.4
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 97.07
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 95.91
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 93.99
COG4109 432 Predicted transcriptional regulator containing CBS 93.04
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 87.98
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 87.3
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 86.44
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 84.51
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 84.5
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 83.31
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 81.68
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 81.58
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 81.39
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 81.21
PLN02274 505 inosine-5'-monophosphate dehydrogenase 80.89
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
Probab=99.53  E-value=1e-14  Score=101.43  Aligned_cols=58  Identities=26%  Similarity=0.413  Sum_probs=55.4

Q ss_pred             ccccCCCCHHHHHHHHhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850           6 TTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus         6 ~~~~g~l~~~e~~ml~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      +.+.|.++++|++|++|+|+|++++|++|||||++|++++.+.+.+ ++++.+.++|||
T Consensus       183 ~~~~g~~~~~E~~mi~~v~~l~~~~v~eiMtPR~~i~~l~~~~~~~-~~~~~~~~~~~S  240 (429)
T COG1253         183 SAEEGVLEEEEREMINNVLDLDDRTVREIMTPRTDIVALDLTDTVE-ELIELILESGHS  240 (429)
T ss_pred             HHhcCCcCHHHHHHHHHHhccCCcEeeeEeeecccEEEEcCCCCHH-HHHHHHHhCCCC
Confidence            4578999999999999999999999999999999999999999998 799999999998



>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2118|consensus Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query64
3ocm_A 173 Putative membrane protein; structural genomics, PS 99.18
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.18
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.07
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.03
3oco_A153 Hemolysin-like protein containing CBS domains; str 98.74
3t4n_C 323 Nuclear protein SNF4; CBS domain, nucleotide bindi 98.71
2qrd_G 334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 98.6
3k6e_A 156 CBS domain protein; streptococcus pneumoniae TIGR4 98.24
2v8q_E 330 5'-AMP-activated protein kinase subunit gamma-1; p 98.13
3kxr_A 205 Magnesium transporter, putative; cystathionine bet 98.03
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 97.86
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 97.85
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 97.82
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 97.81
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 97.62
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 97.39
3ctu_A 156 CBS domain protein; structural genomics, PSI-2, pr 97.33
2yvy_A 278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 97.28
2emq_A 157 Hypothetical conserved protein; CBS domains, NPPSF 97.14
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 96.95
1yav_A 159 Hypothetical protein BSU14130; cystathionine beta 96.83
4esy_A 170 CBS domain containing membrane protein; structural 96.82
2oux_A 286 Magnesium transporter; 10001B, structural genomics 96.81
3lqn_A 150 CBS domain protein; csgid, structural genomics, un 96.7
4gqw_A 152 CBS domain-containing protein CBSX1, chloroplasti; 96.63
3org_A 632 CMCLC; transporter, transport protein; 3.50A {Cyan 96.33
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 96.28
3sl7_A 180 CBS domain-containing protein CBSX2; CBS-PAIR prot 96.16
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 95.89
3fhm_A 165 Uncharacterized protein ATU1752; CBS domain, proka 95.8
4fry_A 157 Putative signal-transduction protein with CBS DOM; 95.79
2pfi_A 164 Chloride channel protein CLC-Ka; cystathionine bet 95.76
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 95.67
2j9l_A 185 Chloride channel protein 5; ION channel, ION trans 95.36
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 94.92
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 94.89
3ddj_A 296 CBS domain-containing protein; structural genomics 94.85
1o50_A 157 CBS domain-containing predicted protein TM0935; CB 94.47
3kh5_A 280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 94.47
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 94.4
2rih_A 141 Conserved protein with 2 CBS domains; bateman doma 94.04
1pbj_A125 Hypothetical protein; structural genomics, domain, 93.82
3fv6_A 159 YQZB protein; CBS domain dimer, metabolism regulat 93.59
1pbj_A125 Hypothetical protein; structural genomics, domain, 93.31
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 93.09
2o16_A 160 Acetoin utilization protein ACUB, putative; struct 93.01
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 92.71
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 92.55
2d4z_A 250 Chloride channel protein; CLC chloride channel cyt 92.5
4fry_A157 Putative signal-transduction protein with CBS DOM; 92.15
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 91.61
1pvm_A184 Conserved hypothetical protein TA0289; structural 91.58
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 90.96
1pvm_A 184 Conserved hypothetical protein TA0289; structural 90.91
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 90.84
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 90.16
1vr9_A 213 CBS domain protein/ACT domain protein; structural 89.84
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 89.7
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 89.65
1o50_A157 CBS domain-containing predicted protein TM0935; CB 89.52
3ddj_A 296 CBS domain-containing protein; structural genomics 89.29
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 89.22
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 89.16
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 88.91
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 88.59
2o16_A160 Acetoin utilization protein ACUB, putative; struct 88.47
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 87.82
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 87.67
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 87.13
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 87.11
2nyc_A 144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 87.02
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 86.88
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 86.88
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 86.85
2yzq_A 282 Putative uncharacterized protein PH1780; sheet/hel 86.79
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 86.77
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 86.57
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 86.52
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 86.42
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 86.33
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 86.29
3oco_A153 Hemolysin-like protein containing CBS domains; str 86.21
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 86.18
3l2b_A 245 Probable manganase-dependent inorganic pyrophospha 85.94
3lqn_A150 CBS domain protein; csgid, structural genomics, un 85.87
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 85.62
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 85.15
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 85.11
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 85.04
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 84.66
4esy_A170 CBS domain containing membrane protein; structural 83.69
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 82.12
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 82.0
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 80.74
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
Probab=99.18  E-value=1e-11  Score=75.70  Aligned_cols=58  Identities=19%  Similarity=0.269  Sum_probs=51.4

Q ss_pred             ccccCCCCHHHHHHHHhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850           6 TTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus         6 ~~~~g~l~~~e~~ml~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      ++++|.|+++|++++.+++.|.+.+|+++|+|+.++++++.+.++. ++++.+.++||+
T Consensus        13 ~~~~g~l~~~e~~~i~~~l~l~~~~v~diM~~~~~v~~v~~~~tv~-ea~~~m~~~~~~   70 (173)
T 3ocm_A           13 MPAVPAFGVEERNMVSGVLTLAERSIRSIMTPRTDVSWVNIDDDAA-TIRQQLTAAPHS   70 (173)
T ss_dssp             -----CCCHHHHHHHHHHHHHTTSCSTTTSEEGGGCCCEETTSCHH-HHHHHHHHSSCS
T ss_pred             HHhcCCcCHHHHHHHHHHhccCCCCHHHhCCcHHHeEEEeCCCCHH-HHHHHHHhCCCC
Confidence            4778999999999999999999999999999999999999999999 799999999886



>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query64
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 98.12
d2ooxe1 179 Uncharacterized protein C1556.08c {Schizosaccharom 97.96
d2v8qe2 159 5'-AMP-activated protein kinase subunit gamma-1, A 97.52
d2d4za3 160 Chloride channel protein, CBS tandem {Marbled elec 96.45
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 96.22
d3ddja1 141 Uncharacterized protein SSO3205 {Sulfolobus solfat 96.09
d2j9la1 169 Chloride channel protein 5, ClC-5 {Human (Homo sap 95.91
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 95.57
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 95.46
d2o16a3 139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 95.33
d3ddja2 135 Uncharacterized protein SSO3205 {Sulfolobus solfat 95.16
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 95.09
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 94.85
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 93.9
d2yvxa2 144 Magnesium transporter MgtE {Thermus thermophilus [ 92.7
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 92.57
d1pvma4 142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 92.41
d2v8qe1 145 5'-AMP-activated protein kinase subunit gamma-1, A 92.31
d2yzqa1 156 Uncharacterized protein PH1780 {Pyrococcus horikos 92.14
d2ooxe2 153 Uncharacterized protein C1556.08c {Schizosaccharom 90.57
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 89.86
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 89.72
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 88.37
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 88.04
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 88.02
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 87.09
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 86.27
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 85.64
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 85.29
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 85.04
d1o50a3 145 Hypothetical protein TM0935 {Thermotoga maritima [ 84.59
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 81.52
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: Hypothetical protein YkuL
species: Bacillus subtilis [TaxId: 1423]
Probab=98.12  E-value=1.9e-07  Score=52.86  Aligned_cols=36  Identities=17%  Similarity=0.232  Sum_probs=34.3

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      |++|+++|+|..++++++.+.++. ++++.+.++|||
T Consensus         1 e~tv~~~mip~~~v~~v~~~~tl~-~a~~~m~~~~~s   36 (132)
T d1yava3           1 EATVGQFMIEADKVAHVQVGNNLE-HALLVLTKTGYT   36 (132)
T ss_dssp             TCBHHHHSEEGGGSCCEETTCBHH-HHHHHHHHHCCS
T ss_pred             CCCHHHccccccceEEEcCCCCHH-HHHHHHHhhCCC
Confidence            679999999999999999999999 799999999997



>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure