Diaphorina citri psyllid: psy4857

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------

MARQGNRLDSKKVNSELFTLTYGALVSQLLKDYDNVEDVNKQLDRMGYNIGIRLIEDFLARTQSTRCYDFKETAEKIQLGFRIYLGISPNISNWSAGGDEFSLIFETNPMLEFVELPDNCTNLKYCNVLTGVLRGACEMVQLDITSKFIQDQLKGDNVTELRNSELFTLTYGALVSQLLKDYDNVEDVNKQLDRMGYNIGIRLIEDFLARTQSTRCYDFKETAEKIQLGFRIYLGISPNISNWSAGGDEFSLIFETNPMLEFVELPDNCTNLKYCNVLTGVLRGACEMVQLDITSKFIQDQLKGDNVTELRVKFIKTIQDAIPAGED

ccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccEEECccccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEccccccccccccccEEEHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccEEECccccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHcEEEEEEEEEccccccccEEEEEEEEHHcccccccccc

************VNSELFTLTYGALVSQLLKDYDNVEDVNKQLDRMGYNIGIRLIEDFLARTQSTRCYDFKETAEKIQLGFRIYLGISPNISNWSAGGDEFSLIFETNPMLEFVELPDNCTNLKYCNVLTGVLRGACEMVQLDITSKFIQDQLKGDNVTELRNSELFTLTYGALVSQLLKDYDNVEDVNKQLDRMGYNIGIRLIEDFLARTQSTRCYDFKETAEKIQLGFRIYLGISPNISNWSAGGDEFSLIFETNPMLEFVELPDNCTNLKYCNVLTGVLRGACEMVQLDITSKFIQDQLKGDNVTELRVKFIKTIQD*******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MARQGNRLDSKKVNSELFTLTYGALxxxxxxxxxxxxxxxxxxxxxGYNIGIRLIEDFLARTQSTRCYDFKETAEKIQLGFRIYLGISPNISNWSAGGDEFSLIFETNPMLEFVELPDNCTNLKYCNVLTGVLRGACEMVQLDITSKFIQDQLKGDNVTELRNSELFTLTYGALxxxxxxxxxxxxxxxxxxxxxGYNIGIRLIEDFLARTQSTRCYDFKETAEKIQLGFRIYLGISPNISNWSAGGDEFSLIFETNPMLEFVELPDNCTNLKYCNVLTGVLRGACEMVQLDITSKFIQDQLKGDNVTELRVKFIKTIQDAIPAGED

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Trafficking protein particle complex subunit 3	May play a role in vesicular transport from endoplasmic reticulum to Golgi.	confident	Q5ZI57
Trafficking protein particle complex subunit 3	May play a role in vesicular transport from endoplasmic reticulum to Golgi.	confident	Q86K94
Trafficking protein particle complex subunit BET3	Component of the TRAPP I, TRAPP II and TRAPP III complexes which act as guanine nucleotide exchange factors (GEF) for YPT1. TRAPP I plays a key role in the late stages of endoplasmic reticulum to Golgi traffic. TRAPP II plays a role in intra-Golgi transport. TRAPP III plays a role in autophagosome formation. Required for sporulation. Has a role late in meiosis following DNA replication.	confident	P36149

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006888 [BP]	ER to Golgi vesicle-mediated transport	probable	GO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0000139 [CC]	Golgi membrane	probable	GO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0033106 [CC]	cis-Golgi network membrane	probable	GO:0031090, GO:0005801, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030008 [CC]	TRAPP complex	probable	GO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SZ7, chain A
Confidence level:very confident
Coverage over the Query: 161-318
View the alignment between query and template
View the model in PyMOL

Template: 1SZ7, chain A
Confidence level:very confident
Coverage over the Query: 12-164
View the alignment between query and template
View the model in PyMOL