Diaphorina citri psyllid: psy4876

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------61

MSQFAFFNDLNSALNMDEPLTKGPLPRWQRKNKENSSVEMNMSNFNSSNSMSSSDLNKSRGNEERKRSQSVGRKTPKTPKKSPGRHKSNPNTPSAKSKTPSGGDRYIPNRSAIDTELSHYLLTRDENMEDLSPSEREKRKAMSELVHGKDIQKSRVLAFQNKAPPPPDGYQNSLKVALNSAITSSPEMKIWKISVHQNVKSVKLCQNLFMERIFKSLEYLLFKIKPLPHLMAIKILSNTSKTPMGSKPTSRYIPLTADRILDAPEIQNDYYLNLIDWSHFNVLAVALGGSIYLWNGESDSNSKYIICQSPLVQELTSKCIQDNRAIDHLMDLEGNENVCSVAWIQEGYMLGVGTSLGTVQLWDVSAKKKCRTMDGHDVRVGALAWNTYILSSGSRCGNIVHHDVRSRDHKVALLQNHTQEVCGLKWSPDGRYLASGGNDNLLNIWSGVPGQHTFSTQPIHSLSRHQAAVKAIAWCPWSPNVLASGGGTADRHIYFWNVSSGACLDSIDTKSQVCALLWNSDYKELVSAHGFAQNQLIIWKYPSLVKVAELHGHSARVLNLAMSPDETTVLSAGADETLRLWKIFEKVKSKKKEIKNNASKFNSMFNSIR

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccHHHHHHHccccccccccccHHHHcccccccccccccccHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEcccccCEECccccccccEEEEEEcccccEEEEEEccEEEEEEcccccccEEEEECcccccEEEcccccccccccEEEcccccccEEEEEEcccccEEEEEEccccEEEEEccccCEEEEcccccccEEEEEEcccEEEECcccccEEEEEcccccEEEEEEccccccEEEEEEcccccEEEEECccccEEEEccccccccccccccEEcccccccEEEEEEccccccEEEEEcccccccEEEEEcccccEEEEECccccEEEEEEcccccEEEEccccccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEECcccccEEEEEccccccccEEEEEcccccEEEEEEEcc

***FAFFNDLNSAL**********************************************************************************************NRSAIDTEL****************************************************************I***PEMKIWKISVHQNVKSVKLCQNLFMERIFKSLEYLLFKIKPLPHLMAIKILS*************RYIPLTADRILDAPEIQNDYYLNLIDWSHFNVLAVALGGSIYLWNGESDSNSKYIICQSPLVQELTSKCIQDNRAIDHLMDLEGNENVCSVAWIQEGYMLGVGTSLGTVQLWDVSAKKKCRTMDGHDVRVGALAWNTYILSSGSRCGNIVHHDVRSRDHKVALLQNHTQEVCGLKWSPDGRYLASGGNDNLLNIWSGVPGQHTFSTQPIHSLSRHQAAVKAIAWCPWSPNVLASGGGTADRHIYFWNVSSGACLDSIDTKSQVCALLWNSDYKELVSAHGFAQNQLIIWKYPSLVKVAELHGHSARVLNLAMSPDETTVLSAGADETLRLWKIFEKV*************FNSMFNSIR

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Anaphase-promoting complex subunit cdc20	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	confident	Q54MZ3
Cell division cycle protein 20 homolog	Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation.	confident	Q9JJ66
Cell division cycle protein 20 homolog	Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation.	confident	Q5H7C0

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005680 [CC]	anaphase-promoting complex	probable	GO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0000151, GO:0000152, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0031461, GO:0043227, GO:0043226, GO:0044422
GO:0007088 [BP]	regulation of mitosis	probable	GO:0007346, GO:0051726, GO:0033043, GO:0010564, GO:0050794, GO:0051783, GO:0065007, GO:0008150, GO:0051128, GO:0050789
GO:0090129 [BP]	positive regulation of synapse maturation	probable	GO:0019226, GO:0035637, GO:0050803, GO:0050807, GO:0051128, GO:0090128, GO:0023052, GO:0050789, GO:0044699, GO:0065007, GO:0048518, GO:0065008, GO:0051130, GO:0032501, GO:0050793, GO:0050877, GO:0009987, GO:0050794, GO:0008150, GO:0051239, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0051094, GO:0051960, GO:2000026, GO:0044763, GO:0048522
GO:0008284 [BP]	positive regulation of cell proliferation	probable	GO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0022403 [BP]	cell cycle phase	probable	GO:0022402, GO:0009987, GO:0008150, GO:0007049, GO:0044763, GO:0044699
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008054 [BP]	cyclin catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0040020 [BP]	regulation of meiosis	probable	GO:0051445, GO:0051726, GO:2000241, GO:0010564, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0010001 [BP]	glial cell differentiation	probable	GO:0032502, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0042063, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0045732 [BP]	positive regulation of protein catabolic process	probable	GO:0009896, GO:0009894, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0051247, GO:0042176, GO:0065007, GO:0048518, GO:0008150, GO:0019222, GO:0050789, GO:0010604
GO:0048468 [BP]	cell development	probable	GO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0048471 [CC]	perinuclear region of cytoplasm	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0048513 [BP]	organ development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0033597 [CC]	mitotic checkpoint complex	probable	GO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0031572 [BP]	G2 DNA damage checkpoint	probable	GO:0010948, GO:0050789, GO:0044699, GO:0051716, GO:0031570, GO:0010564, GO:0065007, GO:0048519, GO:0009987, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0008150, GO:1901988, GO:0000077, GO:0000075, GO:0051726, GO:0050896, GO:0033554, GO:0044763, GO:0048523
GO:0031965 [CC]	nuclear membrane	probable	GO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045595 [BP]	regulation of cell differentiation	probable	GO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0051093 [BP]	negative regulation of developmental process	probable	GO:0050793, GO:0048519, GO:0065007, GO:0050789, GO:0008150
GO:0009888 [BP]	tissue development	probable	GO:0032502, GO:0048856, GO:0008150
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0007067 [BP]	mitosis	probable	GO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007049
GO:0031145 [BP]	anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0090302 [MF]	mitotic anaphase-promoting complex activity	probable	GO:0019787, GO:0016879, GO:0004842, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0031915 [BP]	positive regulation of synaptic plasticity	probable	GO:0065008, GO:0044057, GO:0031644, GO:0050804, GO:0048167, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0010646, GO:0050789, GO:0050794
GO:0005819 [CC]	spindle	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005814 [CC]	centriole	probable	GO:0005737, GO:0005856, GO:0015630, GO:0043228, GO:0005575, GO:0043232, GO:0005813, GO:0044464, GO:0044444, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044450, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0051488 [BP]	activation of anaphase-promoting complex activity	probable	GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0051438, GO:0050789, GO:0043085, GO:0080090, GO:0051340, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0031396, GO:0065007, GO:0065009, GO:0031398, GO:0060255, GO:0050790, GO:0050794, GO:0048518, GO:0008150, GO:0032268, GO:0051443, GO:0031401, GO:0051351, GO:0048522
GO:0030424 [CC]	axon	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GGC, chain A
Confidence level:very confident
Coverage over the Query: 250-298,324-588
View the alignment between query and template
View the model in PyMOL

Template: 4GGA, chain A
Confidence level:very confident
Coverage over the Query: 250-298,324-588
View the alignment between query and template
View the model in PyMOL

Template: 2OAJ, chain A
Confidence level:confident
Coverage over the Query: 271-450
View the alignment between query and template
View the model in PyMOL