Diaphorina citri psyllid: psy4884


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MTKVNVFHLVICLDLLSFIPTCYPVEDTTEKVIGPLDYENIPSEEFWGTEPRRLINKYYSKHHDVVTDRFTIDTGIHTEAICRCWKSKKFPFCDNSHKYHNKFHKDNVGPLTLKRP
cccccEEHHHHHHccccccccccccccccccEECcEEEEcccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccHHHHcccccccccEEEccc
***VNVFHLVICLDLLSFIPTCYPVEDTTEKVIGPLDYENIPSEEFWGTEPRRLINKYYSKHHDVVTDRFTIDTGIHTEAICRCWKSKKFPFCDNSHKYHNKFHKDNVGPLTLK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKVNVFHLVICLDLLSFIPTCYPVEDTTEKVIGPLDYENIPSEEFWGTEPRRLINKYYSKHHDVVTDRFTIDTGIHTEAICRCWKSKKFPFCDNSHKYHNKFHKDNVGPLTLKRP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005741 [CC]mitochondrial outer membraneprobableGO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FNV, chain A
Confidence level:very confident
Coverage over the Query: 52-115
View the alignment between query and template
View the model in PyMOL
Template: 3TBN, chain A
Confidence level:confident
Coverage over the Query: 16-100
View the alignment between query and template
View the model in PyMOL