Diaphorina citri psyllid: psy4888

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---

MLIHATSLLIVIYLSLCWGKLEDYEFQEIDPPVMTKPRFTLPPGLAERFAEGIRKKVDAKSLADFVKYVPYALVLGGISYGVYKVISPKGHINPNIQKSNSKVVNVINIEDIADTLALCRCWRMYFNPNIQKSNSKVVNVINIEDIADTLALCRCWRSKTFPKCDGSHAQHNQCTGDNRVNKHLYKSEDVVTNRFTVFPSDPPLVLCRCWESKKFPLCDGAHRAHNERNKDNIGPAIISASNKHNLYMNDTSGNETNVAHANENWDSDDKKKK

cccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHccccccccccccccccEEcHHHHHHHHHHHEEEEHccccccccccccccccccEEEEEHHHHHHHHHHHHHcccccccccccccccccEEEEcccccccEEEEEEcccccccccccccccccccccccccccEEEcccccccccEEEccccccEEEEEEcccccccccccccHHHHHccccccccEEEEEccccCEEEccccccccccccccccccccccccc

**IHATSLLIVIYLSLCWGKLEDYEFQEIDPPVMTKPRFTLPPGLAERFAEGIRKKVDAKSLADFVKYVPYALVLGGISYGVYKVISPKGHINPNIQKSNSKVVNVINIEDIADTLALCRCWRMYFNPNIQKSNSKVVNVINIEDIADTLALCRCWRSKTFPKCDGSHAQHNQCTGDNRVNKHLYKSEDVVTNRFTVFPSDPPLVLCRCWESKKFPLCDGAHRAHN****DNIGPAIISASNKHNLYMNDTSGNETNVAH*************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
CDGSH iron-sulfur domain-containing protein 2	Regulator of autophagy that contributes to antagonize BECN1-mediated cellular autophagy at the endoplasmic reticulum. Participates in the interaction of BCL2 with BECN1 and is required for BCL2-mediated depression of endoplasmic reticulum Ca(2+) stores during autophagy. Contributes to BIK-initiated autophagy, while it is not involved in BIK-dependent activation of caspases. Involved in life span control, probably via its function as regulator of autophagy.	confident	Q05B71
CDGSH iron-sulfur domain-containing protein 2 homolog A		confident	C3ZWH9
CDGSH iron-sulfur domain-containing protein 2 homolog B		confident	C4A0P0

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005789 [CC]	endoplasmic reticulum membrane	probable	GO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0051537 [MF]	2 iron, 2 sulfur cluster binding	probable	GO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0042803 [MF]	protein homodimerization activity	probable	GO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0005741 [CC]	mitochondrial outer membrane	probable	GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0031323 [BP]	regulation of cellular metabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EW0, chain A
Confidence level:very confident
Coverage over the Query: 161-242
View the alignment between query and template
View the model in PyMOL

Template: 3EW0, chain A
Confidence level:very confident
Coverage over the Query: 123-188
View the alignment between query and template
View the model in PyMOL