Diaphorina citri psyllid: psy4903


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70---
MKFKMKFSSGENRTREQALMFVADSNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIET
ccEEEEECccccccccEEEEEEEccccEEEEEccccccEEEEEcccccccEEEEEccccEEEEEEccccEEcc
***********NRTREQALMFVADSNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIE*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFKMKFSSGENRTREQALMFVADSNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIET

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0048082 [BP]regulation of adult chitin-containing cuticle pigmentationprobableGO:0048079, GO:0007564, GO:0048070, GO:0008150, GO:0050793, GO:2000026, GO:0051239, GO:0065007, GO:0050789
GO:0040003 [BP]chitin-based cuticle developmentprobableGO:0032502, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699
GO:0030100 [BP]regulation of endocytosisprobableGO:0051049, GO:0051128, GO:0060627, GO:0065007, GO:0008150, GO:0032879, GO:0050789, GO:0050794

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S94, chain A
Confidence level:very confident
Coverage over the Query: 6-73
View the alignment between query and template
View the model in PyMOL