Psyllid ID: psy4903
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 73 | ||||||
| 307208125 | 4539 | Low-density lipoprotein receptor-related | 0.780 | 0.012 | 0.736 | 2e-18 | |
| 332024241 | 4558 | Low-density lipoprotein receptor-related | 0.780 | 0.012 | 0.719 | 5e-18 | |
| 307171853 | 4578 | Low-density lipoprotein receptor-related | 0.780 | 0.012 | 0.719 | 6e-18 | |
| 270015974 | 2145 | hypothetical protein TcasGA2_TC004414 [T | 0.739 | 0.025 | 0.777 | 7e-18 | |
| 195446934 | 4521 | GK25553 [Drosophila willistoni] gi|19416 | 0.767 | 0.012 | 0.75 | 3e-17 | |
| 383859306 | 4572 | PREDICTED: low-density lipoprotein recep | 0.767 | 0.012 | 0.696 | 4e-17 | |
| 312381670 | 4689 | hypothetical protein AND_05975 [Anophele | 0.767 | 0.011 | 0.732 | 5e-17 | |
| 157124457 | 4525 | low-density lipoprotein receptor (ldl) [ | 0.767 | 0.012 | 0.732 | 5e-17 | |
| 281360654 | 4769 | megalin, isoform A [Drosophila melanogas | 0.767 | 0.011 | 0.732 | 8e-17 | |
| 198471567 | 4543 | GA11430 [Drosophila pseudoobscura pseudo | 0.767 | 0.012 | 0.732 | 8e-17 |
| >gi|307208125|gb|EFN85629.1| Low-density lipoprotein receptor-related protein 2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Score = 96.3 bits (238), Expect = 2e-18, Method: Composition-based stats.
Identities = 42/57 (73%), Positives = 50/57 (87%)
Query: 17 QALMFVADSNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIET 73
+ LMF+ADS Q+LRTNMDGT A +VSEAAYK SGVA+DI AKR++WCD+LLDYIET
Sbjct: 438 RGLMFIADSKQVLRTNMDGTNAFPVVSEAAYKVSGVAVDIIAKRIYWCDSLLDYIET 494
|
Source: Harpegnathos saltator Species: Harpegnathos saltator Genus: Harpegnathos Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332024241|gb|EGI64445.1| Low-density lipoprotein receptor-related protein 2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307171853|gb|EFN63508.1| Low-density lipoprotein receptor-related protein 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|270015974|gb|EFA12422.1| hypothetical protein TcasGA2_TC004414 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|195446934|ref|XP_002070989.1| GK25553 [Drosophila willistoni] gi|194167074|gb|EDW81975.1| GK25553 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|383859306|ref|XP_003705136.1| PREDICTED: low-density lipoprotein receptor-related protein 2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|312381670|gb|EFR27366.1| hypothetical protein AND_05975 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|157124457|ref|XP_001660469.1| low-density lipoprotein receptor (ldl) [Aedes aegypti] gi|108873980|gb|EAT38205.1| AAEL009869-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|281360654|ref|NP_001096924.2| megalin, isoform A [Drosophila melanogaster] gi|272506047|gb|ABW09371.2| megalin, isoform A [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|198471567|ref|XP_001355664.2| GA11430 [Drosophila pseudoobscura pseudoobscura] gi|198145975|gb|EAL32723.2| GA11430 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 73 | ||||||
| FB|FBgn0261260 | 4769 | mgl "Megalin" [Drosophila mela | 0.753 | 0.011 | 0.745 | 2.7e-15 | |
| FB|FBgn0000119 | 1678 | arr "arrow" [Drosophila melano | 0.726 | 0.031 | 0.403 | 0.00032 |
| FB|FBgn0261260 mgl "Megalin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 213 (80.0 bits), Expect = 2.7e-15, P = 2.7e-15
Identities = 41/55 (74%), Positives = 48/55 (87%)
Query: 19 LMFVADSNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIET 73
LMFVAD Q+LR +MDGT A SIVSEAAYKASGV +DI +KR+FWCD+LLDYIE+
Sbjct: 627 LMFVADGGQVLRAHMDGTHARSIVSEAAYKASGVTVDIISKRVFWCDSLLDYIES 681
|
|
| FB|FBgn0000119 arr "arrow" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 73 | |||
| KOG1214|consensus | 1289 | 99.64 | ||
| PF00058 | 42 | Ldl_recept_b: Low-density lipoprotein receptor rep | 99.58 | |
| KOG1214|consensus | 1289 | 99.57 | ||
| KOG1215|consensus | 877 | 99.21 | ||
| smart00135 | 43 | LY Low-density lipoprotein-receptor YWTD domain. T | 98.9 | |
| smart00135 | 43 | LY Low-density lipoprotein-receptor YWTD domain. T | 98.79 | |
| KOG1215|consensus | 877 | 98.68 | ||
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 98.1 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 98.08 | |
| PF03088 | 89 | Str_synth: Strictosidine synthase; InterPro: IPR01 | 98.01 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 97.88 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 97.65 | |
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 97.18 | |
| KOG1520|consensus | 376 | 97.1 | ||
| PF03022 | 287 | MRJP: Major royal jelly protein; InterPro: IPR0035 | 97.03 | |
| COG3386 | 307 | Gluconolactonase [Carbohydrate transport and metab | 97.0 | |
| COG3386 | 307 | Gluconolactonase [Carbohydrate transport and metab | 96.9 | |
| TIGR02604 | 367 | Piru_Ver_Nterm putative membrane-bound dehydrogena | 96.65 | |
| KOG4659|consensus | 1899 | 96.59 | ||
| PF01436 | 28 | NHL: NHL repeat; InterPro: IPR001258 The NHL repea | 96.53 | |
| PF07995 | 331 | GSDH: Glucose / Sorbosone dehydrogenase; InterPro: | 96.51 | |
| KOG4659|consensus | 1899 | 96.14 | ||
| PF00058 | 42 | Ldl_recept_b: Low-density lipoprotein receptor rep | 95.65 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 95.45 | |
| PF01731 | 86 | Arylesterase: Arylesterase; InterPro: IPR002640 Th | 95.25 | |
| TIGR03606 | 454 | non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH | 95.13 | |
| KOG1520|consensus | 376 | 94.82 | ||
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 94.6 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 93.38 | |
| PF13449 | 326 | Phytase-like: Esterase-like activity of phytase | 92.9 | |
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 92.89 | |
| COG3204 | 316 | Uncharacterized protein conserved in bacteria [Fun | 92.01 | |
| COG3391 | 381 | Uncharacterized conserved protein [Function unknow | 91.69 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 90.52 | |
| PF03088 | 89 | Str_synth: Strictosidine synthase; InterPro: IPR01 | 90.17 | |
| PF03022 | 287 | MRJP: Major royal jelly protein; InterPro: IPR0035 | 88.54 | |
| KOG4499|consensus | 310 | 88.22 | ||
| PF07995 | 331 | GSDH: Glucose / Sorbosone dehydrogenase; InterPro: | 88.22 | |
| PF01731 | 86 | Arylesterase: Arylesterase; InterPro: IPR002640 Th | 87.82 | |
| PF05345 | 49 | He_PIG: Putative Ig domain; InterPro: IPR008009 Th | 86.45 | |
| COG3391 | 381 | Uncharacterized conserved protein [Function unknow | 85.46 | |
| COG2133 | 399 | Glucose/sorbosone dehydrogenases [Carbohydrate tra | 85.15 | |
| TIGR02604 | 367 | Piru_Ver_Nterm putative membrane-bound dehydrogena | 84.86 | |
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 83.91 | |
| KOG4499|consensus | 310 | 81.63 |
| >KOG1214|consensus | Back alignment and domain information |
|---|
Probab=99.64 E-value=3.4e-16 Score=118.32 Aligned_cols=66 Identities=18% Similarity=0.241 Sum_probs=63.5
Q ss_pred ccceEEeCCCCeEEEeC----CCcEEEEEcCCCCeEEEEeCCCceeeEEEEcCCCCeEEEEeCCCCeeeC
Q psy4903 8 SSGENRTREQALMFVAD----SNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIET 73 (73)
Q Consensus 8 ~~g~~~dp~~g~lywtd----~~~I~ra~ldGs~~~~l~~~~~~~p~~lavD~~~~~LYW~D~~~~~ie~ 73 (73)
|+++|+||..|.||||| +++|+++.|||.++++++++++..|+||++|+.++.|+|+|.+..+.||
T Consensus 1113 PR~iv~D~~rgnLYwtDWnRenPkIets~mDG~NrRilin~DigLPNGLtfdpfs~~LCWvDAGt~rleC 1182 (1289)
T KOG1214|consen 1113 PRAIVVDPIRGNLYWTDWNRENPKIETSSMDGENRRILINTDIGLPNGLTFDPFSKLLCWVDAGTKRLEC 1182 (1289)
T ss_pred cceEEeecccCceeeccccccCCcceeeccCCccceEEeecccCCCCCceeCcccceeeEEecCCcceeE
Confidence 78889999999999999 6999999999999999999999999999999999999999999998885
|
|
| >PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1215|consensus | Back alignment and domain information |
|---|
| >smart00135 LY Low-density lipoprotein-receptor YWTD domain | Back alignment and domain information |
|---|
| >smart00135 LY Low-density lipoprotein-receptor YWTD domain | Back alignment and domain information |
|---|
| >KOG1215|consensus | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >KOG1520|consensus | Back alignment and domain information |
|---|
| >PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 | Back alignment and domain information |
|---|
| >COG3386 Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3386 Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain | Back alignment and domain information |
|---|
| >KOG4659|consensus | Back alignment and domain information |
|---|
| >PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases | Back alignment and domain information |
|---|
| >KOG4659|consensus | Back alignment and domain information |
|---|
| >PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides | Back alignment and domain information |
|---|
| >TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family | Back alignment and domain information |
|---|
| >KOG1520|consensus | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >PF13449 Phytase-like: Esterase-like activity of phytase | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >COG3204 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG3391 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 | Back alignment and domain information |
|---|
| >PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 | Back alignment and domain information |
|---|
| >KOG4499|consensus | Back alignment and domain information |
|---|
| >PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases | Back alignment and domain information |
|---|
| >PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides | Back alignment and domain information |
|---|
| >PF05345 He_PIG: Putative Ig domain; InterPro: IPR008009 This alignment represents the conserved core region of a ~90 residue repeat found in several haemagglutinins and other cell surface proteins | Back alignment and domain information |
|---|
| >COG3391 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4499|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 73 | |||
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 7e-12 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 1e-05 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 1e-04 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 1e-11 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 9e-06 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 4e-05 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 2e-11 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 2e-05 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 3e-11 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 6e-05 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 3e-10 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 7e-08 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 4e-05 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 5e-04 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 1e-08 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 4e-07 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 6e-07 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 4e-06 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 2e-05 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 3e-05 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 1e-04 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 4e-08 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 8e-08 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 2e-06 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 6e-06 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 7e-06 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 6e-05 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 2e-04 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 1e-07 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 3e-06 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 1e-05 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 3e-05 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 1e-07 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 3e-07 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 2e-06 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 2e-07 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 4e-06 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 9e-06 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 1e-04 |
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
Score = 57.5 bits (138), Expect = 7e-12
Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 3/57 (5%)
Query: 19 LMFVADSNQ---ILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIE 72
M+ D I + ++G S+V+E +G+ LD+ + RL+W D+ L I
Sbjct: 215 FMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSIS 271
|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 73 | |||
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 99.72 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 99.7 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 99.67 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 99.66 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 99.64 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 99.64 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 99.63 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 99.61 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 99.61 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 99.6 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 99.46 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 99.46 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 99.44 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 99.43 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 99.42 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 99.42 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 99.37 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 99.29 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 99.24 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 99.14 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 98.66 | |
| 3s25_A | 302 | Hypothetical 7-bladed beta-propeller-like protein; | 98.62 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 98.43 | |
| 3s25_A | 302 | Hypothetical 7-bladed beta-propeller-like protein; | 98.41 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 98.37 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 98.25 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 98.21 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 98.06 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 98.01 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 97.9 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 97.85 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 97.81 | |
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 97.73 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 97.61 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 97.59 | |
| 3a9g_A | 354 | Putative uncharacterized protein; PQQ dependent de | 97.59 | |
| 2g8s_A | 353 | Glucose/sorbosone dehydrogenases; bladed beta-prop | 97.51 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 97.42 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 97.39 | |
| 2ism_A | 352 | Putative oxidoreductase; BL41XU spring-8, bladed b | 97.38 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 97.31 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 97.27 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 97.21 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 97.21 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 97.17 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 97.16 | |
| 3das_A | 347 | Putative oxidoreductase; aldose sugar dehydrogenas | 97.09 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 97.08 | |
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 97.07 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 97.05 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 96.99 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 96.92 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 96.81 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 96.76 | |
| 1cru_A | 454 | Protein (soluble quinoprotein glucose dehydrogena; | 96.71 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 96.63 | |
| 3a9g_A | 354 | Putative uncharacterized protein; PQQ dependent de | 96.62 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 96.59 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 96.56 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 96.55 | |
| 3sre_A | 355 | PON1, serum paraoxonase; directed evolution, 6-bla | 96.51 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 96.49 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 96.39 | |
| 3sre_A | 355 | PON1, serum paraoxonase; directed evolution, 6-bla | 96.18 | |
| 2ism_A | 352 | Putative oxidoreductase; BL41XU spring-8, bladed b | 96.07 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 95.87 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 95.85 | |
| 3q6k_A | 381 | 43.2 kDa salivary protein; beta propeller, binding | 95.71 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 95.63 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 95.39 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 95.28 | |
| 2p9w_A | 334 | MAL S 1 allergenic protein; beta propeller; 1.35A | 95.26 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 95.05 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 95.01 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 94.8 | |
| 2p9w_A | 334 | MAL S 1 allergenic protein; beta propeller; 1.35A | 94.75 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 94.72 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 94.53 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 94.42 | |
| 2g8s_A | 353 | Glucose/sorbosone dehydrogenases; bladed beta-prop | 94.03 | |
| 3q6k_A | 381 | 43.2 kDa salivary protein; beta propeller, binding | 93.79 | |
| 1cru_A | 454 | Protein (soluble quinoprotein glucose dehydrogena; | 93.77 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 93.45 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 93.26 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 92.99 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 92.96 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 92.76 | |
| 3das_A | 347 | Putative oxidoreductase; aldose sugar dehydrogenas | 91.91 | |
| 2ece_A | 462 | 462AA long hypothetical selenium-binding protein; | 91.79 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 91.57 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 91.53 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 90.98 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 90.18 | |
| 3amr_A | 355 | 3-phytase; beta-propeller, phytate, MYO-inositol h | 89.62 | |
| 4a9v_A | 592 | PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona | 87.71 | |
| 3amr_A | 355 | 3-phytase; beta-propeller, phytate, MYO-inositol h | 86.75 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 86.18 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 85.57 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 84.68 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 83.86 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 83.68 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 82.44 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 81.93 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 81.75 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 81.06 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 80.18 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 80.06 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 80.01 |
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
Probab=99.72 E-value=1.6e-17 Score=120.89 Aligned_cols=67 Identities=27% Similarity=0.393 Sum_probs=62.6
Q ss_pred eccceEEeCCCCeEEEeC--C-C-cEEEEEcCCCCeEEEEeCCCceeeEEEEcCCCCeEEEEeCCCCeeeC
Q psy4903 7 FSSGENRTREQALMFVAD--S-N-QILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIET 73 (73)
Q Consensus 7 ~~~g~~~dp~~g~lywtd--~-~-~I~ra~ldGs~~~~l~~~~~~~p~~lavD~~~~~LYW~D~~~~~ie~ 73 (73)
-|+||++||.+|+||||| . + +|+|+.|||+++++++.+++.+|+||++|..+++|||+|...++||+
T Consensus 433 ~Pr~iavdp~~g~ly~tD~g~~~~~I~r~~~dG~~~~~l~~~~l~~P~gla~D~~~~~LYw~D~~~~~I~~ 503 (628)
T 4a0p_A 433 RPRAVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIES 503 (628)
T ss_dssp CEEEEEEETTTTEEEEEEEETTEEEEEEEETTSCSCEEEECSSCSCEEEEEEETTTTEEEEEETTTTEEEE
T ss_pred ceeeEEEecCCCeEEEeecCCCCCeEEEEeCCCCCcEEEEeccCCCccEEEEeCCCCEEEEEeCCCCEEEE
Confidence 488999999999999999 3 3 89999999999999999999999999999999999999999998874
|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* | Back alignment and structure |
|---|
| >2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* | Back alignment and structure |
|---|
| >2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* | Back alignment and structure |
|---|
| >1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A | Back alignment and structure |
|---|
| >4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* | Back alignment and structure |
|---|
| >3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 73 | ||||
| d1ijqa1 | 266 | b.68.5.1 (A:377-642) Low density lipoprotein (LDL) | 2e-04 | |
| d1npea_ | 263 | b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId | 0.003 | |
| d1npea_ | 263 | b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId | 0.004 |
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
class: All beta proteins fold: 6-bladed beta-propeller superfamily: YWTD domain family: YWTD domain domain: Low density lipoprotein (LDL) receptor species: Human (Homo sapiens) [TaxId: 9606]
Score = 34.9 bits (79), Expect = 2e-04
Identities = 8/54 (14%), Positives = 24/54 (44%), Gaps = 1/54 (1%)
Query: 18 ALMFVADSNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYI 71
A +F + +++ + +D + S++ + ++ + R++W D I
Sbjct: 2 AYLFFTNRHEVRKMTLDRSEYTSLIPNLRN-VVALDTEVASNRIYWSDLSQRMI 54
|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 | Back information, alignment and structure |
|---|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 73 | |||
| d1ijqa1 | 266 | Low density lipoprotein (LDL) receptor {Human (Hom | 99.75 | |
| d1npea_ | 263 | Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | 99.72 | |
| d1npea_ | 263 | Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | 99.6 | |
| d1ijqa1 | 266 | Low density lipoprotein (LDL) receptor {Human (Hom | 99.5 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 98.46 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 98.41 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 97.93 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 97.91 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 97.09 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 97.08 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 97.07 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 97.04 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 96.67 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 96.31 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 96.18 | |
| d1crua_ | 450 | Soluble quinoprotein glucose dehydrogenase {Acinet | 95.71 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 95.38 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 95.31 | |
| d1v04a_ | 340 | Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory | 95.06 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 94.28 | |
| d1v04a_ | 340 | Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory | 93.14 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 92.83 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 91.17 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 90.65 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 90.03 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 88.09 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 84.9 | |
| d1h6la_ | 353 | Thermostable phytase (3-phytase) {Bacillus amyloli | 84.49 |
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 6-bladed beta-propeller superfamily: YWTD domain family: YWTD domain domain: Low density lipoprotein (LDL) receptor species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.75 E-value=3.4e-18 Score=111.52 Aligned_cols=68 Identities=24% Similarity=0.411 Sum_probs=63.4
Q ss_pred eeccceEEeCCCCeEEEeC---CCcEEEEEcCCCCeEEEEeCCCceeeEEEEcCCCCeEEEEeCCCCeeeC
Q psy4903 6 KFSSGENRTREQALMFVAD---SNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIET 73 (73)
Q Consensus 6 ~~~~g~~~dp~~g~lywtd---~~~I~ra~ldGs~~~~l~~~~~~~p~~lavD~~~~~LYW~D~~~~~ie~ 73 (73)
..|.|+++||..|+|||++ .++|+|++|||+++++++..++..|+||++|..+++|||+|...+.|++
T Consensus 120 ~~P~~l~vd~~~g~ly~~~~~~~~~I~r~~~dGs~~~~l~~~~~~~p~gl~iD~~~~~lYw~d~~~~~I~~ 190 (266)
T d1ijqa1 120 SKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISS 190 (266)
T ss_dssp CCEEEEEEETTTTEEEEEECSSSCEEEEEETTSCCEEEEECSSCSCEEEEEEETTTTEEEEEETTTTEEEE
T ss_pred CCcceEEEEcccCeEEEeccCCCcceeEeccCCCceecccccccceeeEEEeeccccEEEEecCCcCEEEE
Confidence 3578999999999999998 4789999999999999999999999999999999999999999999874
|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} | Back information, alignment and structure |
|---|