Diaphorina citri psyllid: psy4906


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MYRTYPGRQGEIDRCLKKVSEGVETFEDIWQKVHNATNSNQKEKYEADLKKEIKKLQRLRDQIKSWIASAEIKDKSTLLDYRKLIETQMERFKVVERETKTKAYSKEGLGAVQKMDPAQKEKEEISTWLVTSIDALNIQVSSVA
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
****YPGRQGEIDRCLKKVSEGVETFEDIWQKVH***************KKEIKKLQRLRDQIKSWIASAEIKDKSTLLDYRKLIETQMERFKVV*****************************ISTWLVTSIDALNIQVS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYRTYPGRQGEIDRCLKKVSEGVETFEDIWQKVHNATNSNQxxxxxxxxxxxxxxxxxxxxxxxxxxxxAEIKDKSTLLDYRKLIETQMERFKVVERETKTKAYSKEGLGAVQKMDPAQKEKEEISTWLVTSIDALNIQVSSVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CCR4-NOT transcription complex subunit 3 The CCR4-NOT complex functions as general transcription regulation complex.confidentO75175
CCR4-NOT transcription complex subunit 3 The CCR4-NOT complex functions as general transcription regulation complex.confidentQ8K0V4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0032991 [CC]macromolecular complexconfidentGO:0005575
GO:0030014 [CC]CCR4-NOT complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0000932 [CC]cytoplasmic mRNA processing bodyprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:2000036 [BP]regulation of stem cell maintenanceprobableGO:2000736, GO:0050793, GO:0060284, GO:0050794, GO:0045595, GO:0065007, GO:0051239, GO:0008150, GO:0050789
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0000289 [BP]nuclear-transcribed mRNA poly(A) tail shorteningprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0000288, GO:0044260, GO:0071704, GO:0010467, GO:0006401, GO:0006402, GO:0044238, GO:0031124, GO:0009987, GO:0006725, GO:0031123, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439, GO:0006396, GO:0006397
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted