Diaphorina citri psyllid: psy4909

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-
LDELELAGVVPSSATTDSNGTPNSLASTSPHSPTLGLNHSAVTECSSSSVEPNAPSSEKKNKSKMNSEEINASKGMVKPTAVRPLSTTNTSATVPSSSAPSILPQSQQSHNSLMSLNHGTSGATHLRVTNTRAVLNLRRRPPATTTTLTPPPHLWRSRVIAQDVLDKAGLELPPPASDSNSQQQQQQEVYDKSLAPSEAHIPYMLGVVPLGPQPLHKAHHYQYQLVDQAYHHLPTPADSERLRHYITRTPCTTPSYYPQVPLPHSDTLDFFQRLSTESLFFIFYYMEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKLINEDYEQGTYIYFDNEKWSQRKKEGFTFEYKYLEDRDLN
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHccccccccEEEccccccHHHHHHHHHHHHcccEEccccEEEEECccccccccccCEEEEEEEEcccccccccccccEEEcccccccccc
*******************************************************************************************************************************************************************************************************HIPYMLGVVPLGPQPLHKAHHYQYQLVDQAYHHLPTPADSERLRHYITRTPCTTPSYYPQVPLPHSDTLDFFQRLSTESLFFIFYYMEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKLINEDYEQGTYIYFDNEKWSQRKKEGFTFEYKYLEDRD**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LDELELAGVVPSSATTDSNGTPNSLASTSPHSPTLGLNHSAVTECSSSSVEPNAPSSEKKNKSKMNSEEINASKGMVKPTAVRPLSTTNTSATVPSSSAPSILPQSQQSHNSLMSLNHGTSGATHLRVTNTRAVLNLRRRPPATTTTLTPPPHLWRSRVIAQDVLDKAGLELPPPASDSNSQQQQQQEVYDKSLAPSEAHIPYMLGVVPLGPQPLHKAHHYQYQLVDQAYHHLPTPADSERLRHYITRTPCTTPSYYPQVPLPHSDTLDFFQRLSTESLFFIFYYMEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKLINEDYEQGTYIYFDNEKWSQRKKEGFTFEYKYLEDRDLN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CCR4-NOT transcription complex subunit 3 The CCR4-NOT complex functions as general transcription regulation complex.confidentO75175
CCR4-NOT transcription complex subunit 3 The CCR4-NOT complex functions as general transcription regulation complex.confidentQ8K0V4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008150 [BP]biological_processprobable
GO:0030014 [CC]CCR4-NOT complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0000932 [CC]cytoplasmic mRNA processing bodyprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted