Diaphorina citri psyllid: psy4919

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MRESQERTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFVVACDTGRVVVTGLGLPCSDSVDIEKVREQLSTQEPQNAGRILDLKTGTVKKEGHQ
cccccccccccccccccccccccHHHHHHHHHHHcccEEEEEEcccccEEEEEccccccccccHHHHHHHHcccccccccccEEcccccEECcccc
*****************KPSFLTDQELKHLILEAADGFLFVVACDTGRVVVTGLGLPCSDSVDIEKVREQ**************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRESQERTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFVVACDTGRVVVTGLGLPCSDSVDIEKVREQLSTQEPQNAGRILDLKTGTVKKEGHQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aryl hydrocarbon receptor nuclear translocator Required for activity of the Ah (dioxin) receptor. This protein is required for the ligand-binding subunit to translocate from the cytosol to the nucleus after ligand binding. The complex then initiates transcription of genes involved in the activation of PAH procarcinogens. The heterodimer with HIF1A or EPAS1/HIF2A functions as a transcriptional regulator of the adaptive response to hypoxia.confidentP27540
Aryl hydrocarbon receptor nuclear translocator Required for activity of the Ah (dioxin) receptor. This protein is required for the ligand-binding subunit to translocate from the cytosol to the nucleus after ligand binding. The complex then initiates transcription of genes involved in the activation of PAH procarcinogens. The heterodimer with HIF1A or EPAS1/HIF2A functions as a transcriptional regulator of the adaptive response to hypoxia.confidentP41739
Aryl hydrocarbon receptor nuclear translocator Required for activity of the Ah (dioxin) receptor. This protein is required for the ligand-binding subunit to translocate from the cytosol to the nucleus after ligand binding. The complex then initiates transcription of genes involved in the activation of PAH procarcinogens. The heterodimer with HIF1A or EPAS1/HIF2A functions as a transcriptional regulator of the adaptive response to hypoxia.confidentP53762

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043565 [MF]sequence-specific DNA bindingconfidentGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityconfidentGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0071456 [BP]cellular response to hypoxiaconfidentGO:0009628, GO:0051716, GO:0070887, GO:0036293, GO:0050896, GO:0009987, GO:0071453, GO:0036294, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0001666, GO:0044699, GO:0070482
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterconfidentGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0032869 [BP]cellular response to insulin stimulusconfidentGO:0070887, GO:0032868, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:0071417, GO:0071310, GO:0071495, GO:0009987, GO:0032870, GO:0044763, GO:0010243, GO:0042221, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0050896, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:1901698
GO:0046886 [BP]positive regulation of hormone biosynthetic processprobableGO:0009889, GO:0032352, GO:0019222, GO:0032350, GO:0031326, GO:0031325, GO:0031328, GO:0031323, GO:0050794, GO:0065007, GO:0046885, GO:0048518, GO:0008150, GO:0048522, GO:0009891, GO:0050789, GO:0009893
GO:0033235 [BP]positive regulation of protein sumoylationprobableGO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0031325, GO:0031401, GO:0031323, GO:0051247, GO:0050794, GO:0008150, GO:0048518, GO:0032270, GO:0031399, GO:0033233, GO:0065007, GO:0019222, GO:0010604, GO:0050789, GO:0048522
GO:0048813 [BP]dendrite morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0009636 [BP]response to toxic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0008347 [BP]glial cell migrationprobableGO:0040011, GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048870, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0042063, GO:0006928, GO:0008150, GO:0051674, GO:0044763, GO:0007275, GO:0048731, GO:0022008, GO:0016477, GO:0051179, GO:0044699
GO:0009968 [BP]negative regulation of signal transductionprobableGO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0009967 [BP]positive regulation of signal transductionprobableGO:0009966, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0007424 [BP]open tracheal system developmentprobableGO:0060541, GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007422 [BP]peripheral nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0043619 [BP]regulation of transcription from RNA polymerase II promoter in response to oxidative stressprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0070887, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0043618, GO:0019219, GO:0006357, GO:0065007, GO:0010468, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0006950, GO:0008150, GO:0051171, GO:2001141, GO:0042221, GO:0034599, GO:0006979, GO:0043620, GO:0050896, GO:0051252, GO:0006355, GO:0010556, GO:0033554, GO:0044763
GO:0010575 [BP]positive regulation vascular endothelial growth factor productionprobableGO:0051240, GO:0010574, GO:0001817, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0050789, GO:0001819
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0007517 [BP]muscle organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0007275, GO:0044699
GO:0003714 [MF]transcription corepressor activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0003713 [MF]transcription coactivator activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0017162 [MF]aryl hydrocarbon receptor bindingprobableGO:0005102, GO:0003674, GO:0008134, GO:0005515, GO:0005488
GO:0003208 [BP]cardiac ventricle morphogenesisprobableGO:0003205, GO:0044767, GO:0009887, GO:0003206, GO:0044707, GO:0007507, GO:0048513, GO:0032501, GO:0048856, GO:0003007, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0003231, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0051879 [MF]Hsp90 protein bindingprobableGO:0031072, GO:0003674, GO:0005488, GO:0005515
GO:0048798 [BP]swim bladder inflationprobableGO:0032502, GO:0032501, GO:0044707, GO:0048799, GO:0048796, GO:0048794, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0071695, GO:0048731, GO:0009653, GO:0010259, GO:0007275, GO:0044699
GO:0009410 [BP]response to xenobiotic stimulusprobableGO:0042221, GO:0050896, GO:0008150
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0009648 [BP]photoperiodismprobableGO:0008150, GO:0009314, GO:0050896, GO:0009416, GO:0009628
GO:0032355 [BP]response to estradiol stimulusprobableGO:1901700, GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0014070, GO:0009725, GO:0043627, GO:0042221, GO:0097305, GO:0010033, GO:0048545
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0071542 [BP]dopaminergic neuron differentiationprobableGO:0032502, GO:0048699, GO:0009987, GO:0030182, GO:0007399, GO:0044707, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0021591 [BP]ventricular system developmentprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0061418 [BP]regulation of transcription from RNA polymerase II promoter in response to hypoxiaprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0070887, GO:0001666, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0043618, GO:0019219, GO:0071453, GO:0010556, GO:0065007, GO:0071456, GO:0043620, GO:0010468, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0006950, GO:0044763, GO:0051171, GO:2001141, GO:0042221, GO:0070482, GO:0009628, GO:0036293, GO:0050896, GO:0051252, GO:0036294, GO:0006355, GO:0006357, GO:0033554, GO:0008150
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0016337 [BP]cell-cell adhesionprobableGO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0000060 [BP]protein import into nucleus, translocationprobableGO:0034504, GO:0051169, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0071702, GO:0051641, GO:0034613, GO:0017038, GO:0006810, GO:0006606, GO:0006913, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0051170, GO:0051649, GO:0044744, GO:0051234, GO:0051179, GO:0016482, GO:0033036, GO:0046907, GO:0044763, GO:0033365, GO:0008150, GO:0009987
GO:0032922 [BP]circadian regulation of gene expressionprobableGO:0032501, GO:0007623, GO:0019222, GO:0044707, GO:0060255, GO:0050789, GO:0048511, GO:0008150, GO:0065007, GO:0010468, GO:0044699
GO:0072576 [BP]liver morphogenesisprobableGO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0061008, GO:0048856, GO:0044767, GO:0048513, GO:0001889, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0042176 [BP]regulation of protein catabolic processprobableGO:0009894, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0065007, GO:0008150, GO:0050789
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0001892 [BP]embryonic placenta developmentprobableGO:0032502, GO:0001701, GO:0044707, GO:0048568, GO:0032501, GO:0048856, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0044699, GO:0009792, GO:0048731, GO:0043009, GO:0007275, GO:0001890
GO:0016604 [CC]nuclear bodyprobableGO:0044446, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0004874 [MF]aryl hydrocarbon receptor activityprobableGO:0003674, GO:0038023, GO:0004872, GO:0004871, GO:0060089
GO:0001190 [MF]RNA polymerase II transcription factor binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0001076, GO:0003674, GO:0000989, GO:0000988
GO:0030522 [BP]intracellular receptor mediated signaling pathwayprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0021979 [BP]hypothalamus cell differentiationprobableGO:0032502, GO:0021536, GO:0048856, GO:0007420, GO:0044707, GO:0048869, GO:0032501, GO:0030154, GO:0044763, GO:0030900, GO:0044767, GO:0007399, GO:0048513, GO:0021854, GO:0008150, GO:0021761, GO:0048731, GO:0009987, GO:0007275, GO:0044699, GO:0007417

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F3L, chain B
Confidence level:very confident
Coverage over the Query: 3-74
View the alignment between query and template
View the model in PyMOL