Diaphorina citri psyllid: psy4920


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MCMVMEISALHALHLTLDHATPLRNEYSESIGCQIIKQDDVTQEGLSGLKSCPPDGLVWRLAICSSHALYSMGGAKSFAHVWFEFVQELRYRWENSLRIPGVKKKSLEALV
ccHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHcccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccc
**MVMEISALHALHLTLDHATPLRNE****IGCQIIK****TQEGLSGLKSCPPDGLVWRLAICSSHALYSMGGAKSFAHVWFEFVQELRYRWENSLRIPGVKKK******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCMVMEISALHALHLTLDHATPLRNEYSESIGCQIIKQDDVTQEGLSGLKSCPPDGLVWRLAICSSHALYSMGGAKSFAHVWFEFVQELRYRWENSLRIPGVKKKSLEALV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Rab3 GTPase-activating protein catalytic subunit Probable catalytic subunit of a GTPase activating protein that has specificity for Rab3 subfamily. Rab3 proteins are involved in regulated exocytosis of neurotransmitters and hormones. Specifically converts active Rab3-GTP to the inactive form Rab3-GDP.confidentQ6NUV0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted