Diaphorina citri psyllid: psy4931

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------

MRIETCYFCSSKIYPGHGIQFVRNDCKIFRFCRSKCHKLFKRKKNPRKTAWTKAYRKVRGKDLAVDPSFEFAKRRNVPLKYDREFWNKTVEAIKKVEHIKTKRQNLYLAQRLRKAREVETARDIKAVQRDIAILNDPTEAIKAKKKRMVEAGIVEEIHESENEAEENMEVDTHWETNEDKLTYIKI

ccEEEEccccccccccccEEEEECcccEEEEEcHHHHHHHHcccccccccHHHHHHHHccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc

MRIETCYFCSSKIYPGHGIQFVRNDCKIFRFCRSKCHKLFKRKKNPRKTAWTKAYRKVRGKDLAVDPSFEFAKRRNVPLKYDREFWNKTVEAIKKVEHIKTKRQNLYLAQRLRKAREVETARDIKAVQRDIAILNDP**********************************************I**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MRIETCYFCSSKIYPGHGIQFVRNDCKIFRFCRSKCHKLFKRKKNPRKTAWTKAYRKVRGKDLAVDPSFEFAKRRNVPLKYDREFWNKTVEAIKKVEHIKTKRQNLYLAQRLRKAREVETARDIKAVQRDIAILNDPTEAIKAKKKRMVEAGIVEEIHESENEAEENMEVDTHWETNEDKLTYIKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable ribosome biogenesis protein RLP24	Involved in the biogenesis of the 60S ribosomal subunit. Ensures the docking of GTPBP4/NOG1 to pre-60S particles.	very confident	Q6P6G7
Probable ribosome biogenesis protein RLP24	Involved in the biogenesis of the 60S ribosomal subunit. Ensures the docking of GTPBP4/NOG1 to pre-60S particles.	very confident	Q3SZ12
Probable ribosome biogenesis protein RLP24	Involved in the biogenesis of the 60S ribosomal subunit. Ensures the docking of GTPBP4/NOG1 to pre-60S particles.	very confident	Q99L28

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0022625 [CC]	cytosolic large ribosomal subunit	confident	GO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0043226, GO:0044424, GO:0015934, GO:0043228, GO:0030529, GO:0032991, GO:0044422
GO:0005730 [CC]	nucleolus	confident	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030687 [CC]	preribosome, large subunit precursor	probable	GO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0001671 [MF]	ATPase activator activity	probable	GO:0003674, GO:0030234, GO:0060589, GO:0008047, GO:0060590
GO:0001510 [BP]	RNA methylation	probable	GO:0016070, GO:0006139, GO:0043170, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0009451, GO:0090304, GO:0071704, GO:0043412, GO:0006807, GO:0043414, GO:0008152, GO:0008150, GO:0032259, GO:1901360, GO:0046483
GO:0040035 [BP]	hermaphrodite genitalia development	probable	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0070887 [BP]	cellular response to chemical stimulus	probable	GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0006364 [BP]	rRNA processing	probable	GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0042254, GO:0071704, GO:0010467, GO:0071840, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0042273 [BP]	ribosomal large subunit biogenesis	probable	GO:0022613, GO:0044085, GO:0008150, GO:0042254, GO:0071840
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0009507 [CC]	chloroplast	probable	GO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0002181 [BP]	cytoplasmic translation	probable	GO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576, GO:0006412
GO:0010171 [BP]	body morphogenesis	probable	GO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0003723 [MF]	RNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0040007 [BP]	growth	probable	GO:0008150
GO:0003735 [MF]	structural constituent of ribosome	probable	GO:0003674, GO:0005198
GO:0040010 [BP]	positive regulation of growth rate	probable	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0006898 [BP]	receptor-mediated endocytosis	probable	GO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A17, chain T
Confidence level:very confident
Coverage over the Query: 1-60
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3izc, chain Z		very confident	Alignment \| Template Structure