Diaphorina citri psyllid: psy4941


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MSRLDSKLTLLRSVQVDLNEESRGNDRLGEALATRLASEARPAETAKYKLHVQEVGHITSLLLGLSGRLARAENALIGLREDHCDRKSLEEKRDKLASQLEEAKELKENIDRRSTNVATLLRKYLSSEEFADYNHFINMKAKLLVDAREISDKIQLGEEQLAALQETMEGES
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccc
***********RSVQVDLNEESRGNDRLGEALATRLASEARPAETAKYKLHVQEVGHITSLLLGLSGRLARAENALIGLR***************************ENIDRRSTNVATLLRKYLSSEEFADYNHFINMKAKLLVDAREISDKIQLGEEQLAA**E******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRLDSKLTLLRSVQVDLNEESRGNDRLGEALATRLASEARPAETAKYKLHVQEVGHITSLLLGLSGRLARAENALIGLREDHCDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYLSSEEFADYNHFINMKAKLLVDxxxxxxxxxxxxxxxxxxxxxMEGES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051128 [BP]regulation of cellular component organizationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0000902 [BP]cell morphogenesisprobableGO:0032502, GO:0009987, GO:0048869, GO:0048856, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009653, GO:0044699
GO:0003779 [MF]actin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0030864 [CC]cortical actin cytoskeletonprobableGO:0005856, GO:0005737, GO:0043228, GO:0015629, GO:0043232, GO:0030863, GO:0044444, GO:0071944, GO:0044422, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005938, GO:0005575, GO:0044424, GO:0044464, GO:0043226, GO:0044448
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0030036 [BP]actin cytoskeleton organizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0043296 [CC]apical junction complexprobableGO:0005575, GO:0030054, GO:0005911
GO:0005912 [CC]adherens junctionprobableGO:0005575, GO:0070161, GO:0030054

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3THF, chain A
Confidence level:very confident
Coverage over the Query: 1-167
View the alignment between query and template
View the model in PyMOL