Diaphorina citri psyllid: psy4946


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MLSNTFDVSSMDSRSTSTARSPGRYNMGTLEASRLDDEHKLIARYAAKLAAENRSVGKAPSEGSLSLDTSRAQRELVSQLESKNREIMREIARLRRQQELEGVCASGFEDNPALMSELRALRMRKDELESHLASLQDSRRHLMVQLEGLMRLLKTHQGTSPNSSP
ccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
**************************************HKLIARY************************************************************************************************LMVQLEG*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSNTFDVSSMDSRSTSTARSPGRYNMGTLEASRLDDEHKLIARYAAKLAAENRSVGKAPSEGSLSLDTSRAQRELxxxxxxxxxxxxxxxxxxxxxxxxEGVCASGFEDNPALMSExxxxxxxxxxxxxxxxxxxxxRRHLMVQLEGLMRLLKTHQGTSPNSSP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dystrobrevin beta confidentP84060
Dystrobrevin beta confidentO70585

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0045202 [CC]synapseprobableGO:0005575
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A7P, chain A
Confidence level:probable
Coverage over the Query: 70-152
View the alignment between query and template
View the model in PyMOL
Template: 1WLE, chain A
Confidence level:probable
Coverage over the Query: 46-146
View the alignment between query and template
View the model in PyMOL