Diaphorina citri psyllid: psy4949


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-----
HTIDIWNVIEAFRENGLNAIELQSDVSVARFETLLSSLYHNLNKRLPVSQQVHVEVLSGLLLNWLLSAYSVESLGRIRVFSIKVALATMCSGKLMDKLRYIFSQLCDCNGHLVAWKFNEYLQDVLAIPAAVLESPSFSYTDTLAQEIFSGNGKVTVNDFMDTMMSEPGPACLIWLPLLHRLTAVESTSHPIACDACGRANFVGFRYRCAKCGNFQMCQECFWWGRVSGGHNLEHEVKENHPVNKLVTRYANHFAVFRKKLKPTIYHGFLRSQRKR
ccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHccccccccHHHHHHHHHcccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEcccccHHHHHHHHHHHcccccccccccccccccccc
HTIDIWNVIEAFRENGLNAIELQSDVSVARFETLLSSLYHNLNKRLPVSQQVHVEVLSGLLLNWLLSAYSVESLGRIRVFSIKVALATMCSGKLMDKLRYIFSQLCDCNGHLVAWKFNEYLQDVLAIPAAVLESPSFSYTDTLAQEIFSGNGKVTVNDFMDTMMSEPGPACLIWLPLLHRLTAVESTSHPIACDACGRANFVGFRYRCAKCGNFQMCQECFWWGRVSGGHNLEHEVKENHPVNKLVTRYANHFAVFRKKLKPTIYHGFLRS****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HTIDIWNVIEAFRENGLNAIELQSDVSVARFETLLSSLYHNLNKRLPVSQQVHVEVLSGLLLNWLLSAYSVESLGRIRVFSIKVALATMCSGKLMDKLRYIFSQLCDCNGHLVAWKFNEYLQDVLAIPAAVLESPSFSYTDTLAQEIFSGNGKVTVNDFMDTMMSEPGPACLIWLPLLHRLTAVESTSHPIACDACGRANFVGFRYRCAKCGNFQMCQECFWWGRVSGGHNLEHEVKENHPVNKLVTRYANHFAVFRKKLKPTIYHGFLRSQRKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dystrobrevin-1 Plays a role in cholinergic transmission and as a functional partner of dystrophin (dys-1), necessary for muscle maintenance.confidentQ9Y048

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044422 [CC]organelle partprobableGO:0005575, GO:0043226
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0016010 [CC]dystrophin-associated glycoprotein complexprobableGO:0043234, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0045202 [CC]synapseprobableGO:0005575
GO:0008092 [MF]cytoskeletal protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EG3, chain A
Confidence level:very confident
Coverage over the Query: 14-186
View the alignment between query and template
View the model in PyMOL
Template: 2E5R, chain A
Confidence level:very confident
Coverage over the Query: 182-242
View the alignment between query and template
View the model in PyMOL