Diaphorina citri psyllid: psy4956

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-

MYIIVHGVHGANLVIKIPENLSSDNSTYRLDYIPAHGHPPPNTTYVSRDIKDNIEFSEGLPGTKYDFYLYYTNSTVHDWLTWTASITTPPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRIIGFTENPPAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKGFSEFDKYQVSINVRRPGASSTPITKSRDEPTQCDMSEGLEPGRTYQVLVKTVSGKP

cEEEEEEECccEEEEEEcccccccccEEEEEEECccccccccEEEECcccccEEEEcccccccEEEEEEEEEEccccccccEEEEEEccccccccEEEEECcccEEEEEECccccccccEEEEEEEEcccccccEEEECccccccEEEEcccccccEEEEEEEEEEcccccccCEEEEEECcccccccEEEEEEcccEEEEEEECcccccccCEEEEEEEcccccccEEEEEECcccccccEEEEcccccccEEEEEEEEEEcccccccEEEEEECcccccccEEEEEECccccEEEEEECcccccccccEEEEEEECccccccEEEECccccccccEEEccccccccEEEEEEEEEEccc

MYIIVHGVHGANLVIKIPENLSSDNSTYRLDYIPAHGH***NTTYVSRDIKDNIEFSEGLPGTKYDFYLYYTNSTVHDWLTWTASITT***PPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRIIGFTENPPAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPSYPASIYTHYKVSIDPP*****************PAQAAFKGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKGFSEFDKYQVSIN********************CDMSEGLEPGRTYQVLVKTVSGKP

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0016324 [CC]	apical plasma membrane	probable	GO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0009987 [BP]	cellular process	probable	GO:0008150
GO:0030424 [CC]	axon	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0004721 [MF]	phosphoprotein phosphatase activity	probable	GO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T1W, chain A
Confidence level:very confident
Coverage over the Query: 10-360
View the alignment between query and template
View the model in PyMOL