Psyllid ID: psy4956


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-
MYIIVHGVHGANLVIKIPENLSSDNSTYRLDYIPAHGHPPPNTTYVSRDIKDNIEFSEGLPGTKYDFYLYYTNSTVHDWLTWTASITTPPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRIIGFTENPPAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKGFSEFDKYQVSINVRRPGASSTPITKSRDEPTQCDMSEGLEPGRTYQVLVKTVSGKP
cEEEEEEEEccEEEEEEcccccccccEEEEEEEEccccccccEEEEEcccccEEEEcccccccEEEEEEEEEEccccccccEEEEEEccccccccEEEEEEcccEEEEEEEccccccccEEEEEEEEcccccccEEEEEccccccEEEEcccccccEEEEEEEEEEcccccccEEEEEEEEcccccccEEEEEEcccEEEEEEEEcccccccEEEEEEEEcccccccEEEEEEEcccccccEEEEcccccccEEEEEEEEEEcccccccEEEEEEEcccccccEEEEEEEccccEEEEEEEcccccccccEEEEEEEEccccccEEEEEccccccccEEEccccccccEEEEEEEEEEccc
cEEEEEEEcccEEEEEEcccccccccEEEEEEEccccccccEEEEcccccccEEEEccccccEEEEEEEEEEEccccccccEEEEEEccccccccEEEEEccccEEEEEEcccccccEcEEEEEEEccccccccEEEEcccccccEEEEcccccccEEEEEEEEEEccccccccEEEEEEccccccccEEEEEccccEEEEEEccccccccccEEEEEEEcccccccEEEEEcccccccccEEEEcccccccEEEEEEEEEEcccccccEEEEEEccccccccEEEEEccccccEEEEEEccccccccEcEEEEEEEccccccEEEEccccccccEEEEEEcccccccEEEEEEEEEcccc
myiivhgvhganlvikipenlssdnstyrldyipahghpppnttyvsrdikdniefseglpgtkydFYLYYTNStvhdwltwtasittppdpptnlsvnvrsgktaqifwsppisgkysgfKLKVISlsektppriigftenppagyslkdltpggsyqvQLFSVydskesvaytsrnfttkpntpgkfIVWFRNETTLLVlwqpsypasiythykvsidppdapesvlyvekegeppgpaqaafkglvpgraynisvqtvsedeistpttaqyrtiplrplsftydkasitsnslrvvweppkgfsefdkYQVSInvrrpgasstpitksrdeptqcdmseglepgrTYQVLVKTVSGKP
MYIIVHgvhganlvikipenLSSDNSTYRLDYIPAHGHPPPNTTYVSRDIKDNIEFSEGLPGTKYDFYLYYTNSTVHDWLTWTASITTPPDPPTNLSVNVRSGKTAQIfwsppisgkySGFKLKVISLSEKTPPRIIGFTENPPAGYSLKDLTPGGSYQVQLFSVYDSKESVAytsrnfttkpntpgkFIVWFRNETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQtvsedeistpttaqyrtiplrplSFTYDKASITSNSLRVVWEPPKGFSEFDKYQVSINvrrpgasstpitksrdeptqcdmseglepgrtyqvlvktvsgkp
MYIIVHGVHGANLVIKIPENLSSDNSTYRLDYIPAHGHPPPNTTYVSRDIKDNIEFSEGLPGTKYDFYLYYTNSTVHDWLTWTASITTPPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRIIGFTENPPAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKGFSEFDKYQVSINVRRPGASSTPITKSRDEPTQCDMSEGLEPGRTYQVLVKTVSGKP
*YIIVHGVHGANLVIKIPENLSSDNSTYRLDYIPAHGH***NTTYVSRDIKDNIEFSEGLPGTKYDFYLYYTNSTVHDWLTWTASITT*********VNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRIIGFTENPPAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPSYPASIYTHYKVSID************************FKGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKGFSEFDKYQVSI*********************************************
MYIIV**VHGANLVIKIPENLSSDNSTYRLDYIP******************NIEFSEGLPGTKYDFYLYYTN******************PPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISL***************PAGYSLKDLTPGGSYQVQLFSVY*****************NTPGKFIVWFRNETTLLVLWQPSYPASIYTHYKVSIDPP*****************PAQAAFKGLVPGRAYNISVQTVSED*********YRTIPLRPLSFTYDKASITSNSLRVVWEPPKGFSEFDKYQVSIN********************CDMSEGLEPGRTYQVLVKTVSGKP
MYIIVHGVHGANLVIKIPENLSSDNSTYRLDYIPAHGHPPPNTTYVSRDIKDNIEFSEGLPGTKYDFYLYYTNSTVHDWLTWTASITTPPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRIIGFTENPPAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKGFSEFDKYQVSINVRRPGASSTPITKSRDEPTQCDMSEGLEPGRTYQVLVKTVSGKP
MYIIVHGVHGANLVIKIPENLSSDNSTYRLDYIPAHGHPPPNTTYVSRDIKDNIEFSEGLPGTKYDFYLYYTNSTVHDWLTWTASITTPPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRIIGFTENPPAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKGFSEFDKYQVSINVRRPGASSTPITKSRDEPTQCDMSEGLEPGRTYQVLVKTVSG**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYIIVHGVHGANLVIKIPENLSSDNSTYRLDYIPAHGHPPPNTTYVSRDIKDNIEFSEGLPGTKYDFYLYYTNSTVHDWLTWTASITTPPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRIIGFTENPPAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKGFSEFDKYQVSINVRRPGASSTPITKSRDEPTQCDMSEGLEPGRTYQVLVKTVSGKP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query361 2.2.26 [Sep-21-2011]
P35992 1631 Tyrosine-protein phosphat no N/A 0.977 0.216 0.659 1e-131
B2RU80 1998 Receptor-type tyrosine-pr yes N/A 0.803 0.145 0.275 2e-11
Q92752 1358 Tenascin-R OS=Homo sapien yes N/A 0.731 0.194 0.280 3e-10
Q00546 1353 Tenascin-R OS=Gallus gall yes N/A 0.695 0.185 0.278 6e-10
Q29116 1746 Tenascin OS=Sus scrofa GN no N/A 0.786 0.162 0.242 8e-10
Q8BYI9 1358 Tenascin-R OS=Mus musculu no N/A 0.722 0.192 0.277 1e-09
Q05546 1356 Tenascin-R OS=Rattus norv no N/A 0.722 0.192 0.277 1e-09
P11276 2477 Fibronectin OS=Mus muscul no N/A 0.908 0.132 0.247 5e-09
Q91740 2481 Fibronectin OS=Xenopus la N/A N/A 0.759 0.110 0.272 1e-08
P04937 2477 Fibronectin OS=Rattus nor no N/A 0.908 0.132 0.242 2e-08
>sp|P35992|PTP10_DROME Tyrosine-protein phosphatase 10D OS=Drosophila melanogaster GN=Ptp10D PE=1 SV=3 Back     alignment and function desciption
 Score =  469 bits (1208), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 236/358 (65%), Positives = 276/358 (77%), Gaps = 5/358 (1%)

Query: 5   VHGVHGANLVIKIPENLS-SDNSTYRLDYIPAHGHPPPNTTYVSRDIKDNIEFSEGLPGT 63
           +  V  A+L I IP N    D ++YRLDY P  G+P PNTT  SR+I D I+FS  LPGT
Sbjct: 37  LKDVRCADLAISIPNNPGLDDGASYRLDYSPPFGYPEPNTTIASREIGDEIQFSRALPGT 96

Query: 64  KYDFYLYYTNSTVHDWLTWTASITTPPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKL 123
           KY+F+LYYTN T HDWLTWT +ITT PDPP+NLSV VRSGK A I WSPP  G Y+ FK+
Sbjct: 97  KYNFWLYYTNFTHHDWLTWTVTITTAPDPPSNLSVQVRSGKNAIILWSPPTQGSYTAFKI 156

Query: 124 KVISLSEKTPPRIIGFTENPPA-GYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTK 182
           KV+ LSE +      F  N     +S+K+LTPG +YQVQ +++YD KESVAYTSRNFTTK
Sbjct: 157 KVLGLSEASSSYNRTFQVNDNTFQHSVKELTPGATYQVQAYTIYDGKESVAYTSRNFTTK 216

Query: 183 PNTPGKFIVWFRNETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQ 242
           PNTPGKFIVWFRNETTLLVLWQP YPA IYTHYKVSI+PPDA +SVLYVEKEGEPPGPAQ
Sbjct: 217 PNTPGKFIVWFRNETTLLVLWQPPYPAGIYTHYKVSIEPPDANDSVLYVEKEGEPPGPAQ 276

Query: 243 AAFKGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEP 302
           AAFKGLVPGRAYNISVQT+SEDEIS PTTAQYRT+PLRPL+ T+D+  ITSNS RV+WE 
Sbjct: 277 AAFKGLVPGRAYNISVQTMSEDEISLPTTAQYRTVPLRPLNVTFDRDFITSNSFRVLWEA 336

Query: 303 PKGFSEFDKYQVSINVRRPGASSTPITKSRDEPTQCDMSEGLEPGRTYQVLVKTVSGK 360
           PKG SEFDKYQVS+   R  ++   + +S +     D  +  EPG+T+ V+VKTVSGK
Sbjct: 337 PKGISEFDKYQVSVATTRRQST---VPRSNEPVAFFDFRDIAEPGKTFNVIVKTVSGK 391




May have a role in axon outgrowth and guidance.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|B2RU80|PTPRB_MOUSE Receptor-type tyrosine-protein phosphatase beta OS=Mus musculus GN=Ptprb PE=1 SV=1 Back     alignment and function description
>sp|Q92752|TENR_HUMAN Tenascin-R OS=Homo sapiens GN=TNR PE=1 SV=3 Back     alignment and function description
>sp|Q00546|TENR_CHICK Tenascin-R OS=Gallus gallus GN=TNR PE=1 SV=1 Back     alignment and function description
>sp|Q29116|TENA_PIG Tenascin OS=Sus scrofa GN=TNC PE=1 SV=1 Back     alignment and function description
>sp|Q8BYI9|TENR_MOUSE Tenascin-R OS=Mus musculus GN=Tnr PE=1 SV=2 Back     alignment and function description
>sp|Q05546|TENR_RAT Tenascin-R OS=Rattus norvegicus GN=Tnr PE=1 SV=1 Back     alignment and function description
>sp|P11276|FINC_MOUSE Fibronectin OS=Mus musculus GN=Fn1 PE=1 SV=4 Back     alignment and function description
>sp|Q91740|FINC_XENLA Fibronectin OS=Xenopus laevis GN=fn1 PE=2 SV=1 Back     alignment and function description
>sp|P04937|FINC_RAT Fibronectin OS=Rattus norvegicus GN=Fn1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query361
340722789 1549 PREDICTED: tyrosine-protein phosphatase 0.952 0.222 0.690 1e-135
328782098 1476 PREDICTED: tyrosine-protein phosphatase 0.952 0.233 0.687 1e-135
380010903 1529 PREDICTED: LOW QUALITY PROTEIN: tyrosine 0.952 0.224 0.687 1e-135
307178534 1562 Tyrosine-protein phosphatase 10D [Campon 0.955 0.220 0.680 1e-135
350418753 1559 PREDICTED: tyrosine-protein phosphatase 0.952 0.220 0.684 1e-134
322799537 1528 hypothetical protein SINV_13485 [Solenop 0.955 0.225 0.672 1e-133
157131409 1523 receptor protein-tyrosine phosphatase 10 0.972 0.230 0.668 1e-133
195447656 1635 GK25195 [Drosophila willistoni] gi|19416 0.988 0.218 0.660 1e-133
195041897 1990 GH12596 [Drosophila grimshawi] gi|193901 0.969 0.175 0.673 1e-133
198471502 1955 GA14821 [Drosophila pseudoobscura pseudo 0.988 0.182 0.660 1e-133
>gi|340722789|ref|XP_003399784.1| PREDICTED: tyrosine-protein phosphatase 10D-like [Bombus terrestris] Back     alignment and taxonomy information
 Score =  488 bits (1256), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 245/355 (69%), Positives = 289/355 (81%), Gaps = 11/355 (3%)

Query: 9   HGANLVIKIPENLSSDNSTYRLDYIPAHGHPPPNTTYVSRDIKDNIEFSEGLPGTKYDFY 68
           + A+L I+IP NLS   S YRLDY PA G+PPPNTT  + DI D I+F +GLPGT+Y+F+
Sbjct: 36  YSADLAIEIPGNLSQGGSWYRLDYSPAVGYPPPNTTIAATDIGDVIKFKDGLPGTRYEFW 95

Query: 69  LYYTNSTVHDWLTWTASITTPPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISL 128
           LYY+NST+HDWLTWTASITT PDPP+NL+V+VR+GKTA ++WSPP  G YSGF+L+V S 
Sbjct: 96  LYYSNSTLHDWLTWTASITTAPDPPSNLTVSVRNGKTAIVYWSPPAQGNYSGFRLRVQSF 155

Query: 129 SEKTPPRIIGFTENPPAG---YSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNT 185
           S+   P+    T   PA    Y L+DL PG +Y +QLF+V D+KESVAYTSRNFTTKPNT
Sbjct: 156 SDTGNPK----TSVIPADAVPYVLRDLIPGATYSLQLFTVLDTKESVAYTSRNFTTKPNT 211

Query: 186 PGKFIVWFRNETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAF 245
           PGKFIVWFRNETTLLVLWQP YPA IYTHYKVSIDP DA ESVLYVEKEGEPPGPAQAAF
Sbjct: 212 PGKFIVWFRNETTLLVLWQPPYPAGIYTHYKVSIDPADAIESVLYVEKEGEPPGPAQAAF 271

Query: 246 KGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKG 305
           KGLVPGRAYNISVQTVSEDE S PTTAQYRT+PLRPL+ T+DK+SITSNS RV W  P+G
Sbjct: 272 KGLVPGRAYNISVQTVSEDETSAPTTAQYRTVPLRPLNVTFDKSSITSNSFRVFWNRPEG 331

Query: 306 FSEFDKYQVSINVRRPGASSTPITKSRDEPTQCDMSEGLEPGRTYQVLVKTVSGK 360
            SEFDKYQ+S+   R  A   P+T++RD+ ++ +  + LEPG+TYQV+VKTVSGK
Sbjct: 332 NSEFDKYQISLGGNRRLA---PVTRNRDDESKWEFKD-LEPGKTYQVVVKTVSGK 382




Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328782098|ref|XP_003250083.1| PREDICTED: tyrosine-protein phosphatase 10D-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380010903|ref|XP_003689555.1| PREDICTED: LOW QUALITY PROTEIN: tyrosine-protein phosphatase 10D-like [Apis florea] Back     alignment and taxonomy information
>gi|307178534|gb|EFN67223.1| Tyrosine-protein phosphatase 10D [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350418753|ref|XP_003491955.1| PREDICTED: tyrosine-protein phosphatase 10D-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|322799537|gb|EFZ20845.1| hypothetical protein SINV_13485 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|157131409|ref|XP_001662235.1| receptor protein-tyrosine phosphatase 10d [Aedes aegypti] gi|108871560|gb|EAT35785.1| AAEL012083-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|195447656|ref|XP_002071311.1| GK25195 [Drosophila willistoni] gi|194167396|gb|EDW82297.1| GK25195 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195041897|ref|XP_001991335.1| GH12596 [Drosophila grimshawi] gi|193901093|gb|EDV99959.1| GH12596 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|198471502|ref|XP_001355649.2| GA14821 [Drosophila pseudoobscura pseudoobscura] gi|198145945|gb|EAL32708.2| GA14821 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query361
FB|FBgn0004370 1631 Ptp10D "Protein tyrosine phosp 0.969 0.214 0.670 6.1e-126
FB|FBgn0004368 1767 Ptp4E "Protein tyrosine phosph 0.983 0.200 0.593 1.4e-107
MGI|MGI:97809 1998 Ptprb "protein tyrosine phosph 0.803 0.145 0.278 6.7e-15
UNIPROTKB|E1BKN2 1358 TNR "Uncharacterized protein" 0.803 0.213 0.292 2.1e-14
UNIPROTKB|F1SS24 2478 FN1 "Uncharacterized protein" 0.880 0.128 0.249 7.1e-14
UNIPROTKB|F1S706 1358 TNR "Uncharacterized protein" 0.803 0.213 0.288 1e-13
UNIPROTKB|Q92752 1358 TNR "Tenascin-R" [Homo sapiens 0.811 0.215 0.288 1.7e-13
MGI|MGI:95566 2477 Fn1 "fibronectin 1" [Mus muscu 0.914 0.133 0.252 4.5e-13
UNIPROTKB|F1NJT3 2483 FN1 "Fibronectin" [Gallus gall 0.775 0.112 0.25 4.5e-13
MGI|MGI:99516 1358 Tnr "tenascin R" [Mus musculus 0.806 0.214 0.283 6.3e-13
FB|FBgn0004370 Ptp10D "Protein tyrosine phosphatase 10D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1237 (440.5 bits), Expect = 6.1e-126, P = 6.1e-126
 Identities = 238/355 (67%), Positives = 275/355 (77%)

Query:     8 VHGANLVIKIPENLS-SDNSTYRLDYIPAHGHPPPNTTYVSRDIKDNIEFSEGLPGTKYD 66
             V  A+L I IP N    D ++YRLDY P  G+P PNTT  SR+I D I+FS  LPGTKY+
Sbjct:    40 VRCADLAISIPNNPGLDDGASYRLDYSPPFGYPEPNTTIASREIGDEIQFSRALPGTKYN 99

Query:    67 FYLYYTNSTVHDWLTWTASITTPPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVI 126
             F+LYYTN T HDWLTWT +ITT PDPP+NLSV VRSGK A I WSPP  G Y+ FK+KV+
Sbjct:   100 FWLYYTNFTHHDWLTWTVTITTAPDPPSNLSVQVRSGKNAIILWSPPTQGSYTAFKIKVL 159

Query:   127 SLSEKTPPRIIGFTENPPA-GYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNT 185
              LSE +      F  N     +S+K+LTPG +YQVQ +++YD KESVAYTSRNFTTKPNT
Sbjct:   160 GLSEASSSYNRTFQVNDNTFQHSVKELTPGATYQVQAYTIYDGKESVAYTSRNFTTKPNT 219

Query:   186 PGKFIVWFRNETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAF 245
             PGKFIVWFRNETTLLVLWQP YPA IYTHYKVSI+PPDA +SVLYVEKEGEPPGPAQAAF
Sbjct:   220 PGKFIVWFRNETTLLVLWQPPYPAGIYTHYKVSIEPPDANDSVLYVEKEGEPPGPAQAAF 279

Query:   246 KGLVPGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKG 305
             KGLVPGRAYNISVQT+SEDEIS PTTAQYRT+PLRPL+ T+D+  ITSNS RV+WE PKG
Sbjct:   280 KGLVPGRAYNISVQTMSEDEISLPTTAQYRTVPLRPLNVTFDRDFITSNSFRVLWEAPKG 339

Query:   306 FSEFDKYQVSINVRRPGASSTPITKSRDEPTQCDMSEGLEPGRTYQVLVKTVSGK 360
              SEFDKYQVS+   R    ST + +S +     D  +  EPG+T+ V+VKTVSGK
Sbjct:   340 ISEFDKYQVSVATTR--RQST-VPRSNEPVAFFDFRDIAEPGKTFNVIVKTVSGK 391


GO:0005001 "transmembrane receptor protein tyrosine phosphatase activity" evidence=ISS;NAS
GO:0005886 "plasma membrane" evidence=ISS;NAS
GO:0004725 "protein tyrosine phosphatase activity" evidence=ISS;NAS;IDA
GO:0006470 "protein dephosphorylation" evidence=IMP;NAS;IDA
GO:0008045 "motor neuron axon guidance" evidence=IGI
GO:0004728 "receptor signaling protein tyrosine phosphatase activity" evidence=NAS
GO:0004721 "phosphoprotein phosphatase activity" evidence=IDA
GO:0007616 "long-term memory" evidence=IMP
GO:0007424 "open tracheal system development" evidence=IGI
GO:0030424 "axon" evidence=IDA
GO:0007417 "central nervous system development" evidence=IGI
GO:0045177 "apical part of cell" evidence=IDA
FB|FBgn0004368 Ptp4E "Protein tyrosine phosphatase 4E" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:97809 Ptprb "protein tyrosine phosphatase, receptor type, B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKN2 TNR "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SS24 FN1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1S706 TNR "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q92752 TNR "Tenascin-R" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:95566 Fn1 "fibronectin 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJT3 FN1 "Fibronectin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:99516 Tnr "tenascin R" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query361
pfam0004184 pfam00041, fn3, Fibronectin type III domain 3e-08
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 9e-07
pfam0004184 pfam00041, fn3, Fibronectin type III domain 5e-06
smart0006083 smart00060, FN3, Fibronectin type 3 domain 2e-05
pfam0004184 pfam00041, fn3, Fibronectin type III domain 3e-05
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 6e-05
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 0.001
smart0006083 smart00060, FN3, Fibronectin type 3 domain 0.002
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
 Score = 50.5 bits (121), Expect = 3e-08
 Identities = 21/85 (24%), Positives = 29/85 (34%), Gaps = 3/85 (3%)

Query: 186 PGKFIVWFRNETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAF 245
           P    V     T+L + W P       T Y+V   P +  E    +     P        
Sbjct: 3   PTNLTVTDVTSTSLTLSWSPPPGNGPITGYEVEYRPVNGGEEWKEIT---VPGTTTSYTL 59

Query: 246 KGLVPGRAYNISVQTVSEDEISTPT 270
            GL PG  Y + VQ V+      P+
Sbjct: 60  TGLKPGTEYEVRVQAVNGAGEGPPS 84


Length = 84

>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 361
KOG4221|consensus 1381 100.0
KOG4221|consensus 1381 100.0
KOG3513|consensus 1051 99.97
KOG3513|consensus1051 99.96
KOG0196|consensus 996 99.65
KOG0196|consensus 996 99.6
KOG4222|consensus 1281 99.59
KOG4258|consensus 1025 99.4
KOG4222|consensus 1281 99.39
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.32
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.18
KOG4258|consensus1025 99.13
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 98.94
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 98.83
KOG4802|consensus516 98.77
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.62
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.49
KOG4802|consensus516 98.42
smart0006083 FN3 Fibronectin type 3 domain. One of three types 98.36
smart0006083 FN3 Fibronectin type 3 domain. One of three types 98.23
COG3401343 Fibronectin type 3 domain-containing protein [Gene 98.17
KOG3632|consensus 1335 98.11
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 97.77
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 97.41
COG3401343 Fibronectin type 3 domain-containing protein [Gene 97.38
KOG4806|consensus454 97.2
KOG3632|consensus 1335 97.13
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 97.04
KOG4806|consensus454 96.87
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 96.84
KOG1225|consensus525 96.57
KOG4367|consensus699 96.41
KOG4367|consensus699 96.33
KOG1225|consensus525 96.1
PF0924099 IL6Ra-bind: Interleukin-6 receptor alpha chain, bi 95.93
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 95.76
KOG4152|consensus830 95.4
COG4733 952 Phage-related protein, tail component [Function un 94.99
KOG4152|consensus830 93.25
KOG1948|consensus1165 92.78
PLN02533 427 probable purple acid phosphatase 92.35
COG4733952 Phage-related protein, tail component [Function un 91.66
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 90.64
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 90.34
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 89.57
PF1034293 GPI-anchored: Ser-Thr-rich glycosyl-phosphatidyl-i 87.26
PLN02533 427 probable purple acid phosphatase 83.99
KOG1948|consensus1165 83.3
KOG0613|consensus 1205 80.39
>KOG4221|consensus Back     alignment and domain information
Probab=100.00  E-value=3.1e-32  Score=247.58  Aligned_cols=340  Identities=20%  Similarity=0.289  Sum_probs=261.8

Q ss_pred             EeCCCceEEEEecCCCCCCCcceEEEEEEcCCCCCCCCeEEeecCccceEEecCCCCCceEEEEEEEecCCcCccceeeE
Q psy4956           5 VHGVHGANLVIKIPENLSSDNSTYRLDYIPAHGHPPPNTTYVSRDIKDNIEFSEGLPGTKYDFYLYYTNSTVHDWLTWTA   84 (361)
Q Consensus         5 ~~~~~~~~l~~~~p~~~~~~~~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~i~V~a~~~~~~~~~~~~~   84 (361)
                      ....+-..+.|..|....+++.-|.+.|.. ++... ++.+...+.....++.+|.|.+.|.|+|+|.+..|..-.+..+
T Consensus       438 ~~~srfi~~tw~~p~~~~g~i~~~~v~~~~-~~~~r-er~~~tss~g~~~tv~nl~p~t~Y~~rv~A~n~~g~g~sS~pL  515 (1381)
T KOG4221|consen  438 LVSSRFIQLTWRPPAQISGNISTYTVFYKV-EGDVR-ERLQNTSSPGIQVTVQNLSPLTMYFFRVRAKNEAGSGESSAPL  515 (1381)
T ss_pred             cccceeEEEeecCccccCCCcceEEEEEec-CCchh-hhheeccCCceEEEeeecccceeEEEEEeccCcccCCccCCce
Confidence            445566778899899888899999999977 33332 3434444323899999999999999999998877565555667


Q ss_pred             EEecCCCCCCccEEEEEeCCEEEEEeeCCC--CCCcccEEEEEEECCCCCCCeEEeecCCCCceEEEcCCCCCcEEEEEE
Q psy4956          85 SITTPPDPPTNLSVNVRSGKTAQIFWSPPI--SGKYSGFKLKVISLSEKTPPRIIGFTENPPAGYSLKDLTPGGSYQVQL  162 (361)
Q Consensus        85 ~~~t~~~~p~~l~~~~~~~~~v~l~W~~p~--~~~~~~y~v~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~p~~~Y~v~v  162 (361)
                      .+.+.+.+|..+.+...+..++.+.|.+|.  ++++.+|++.|...   .....+.+..+.. .++|.+|.+.++|.|+|
T Consensus       516 kV~t~pEgp~~~~a~ats~~ti~v~WepP~~~n~~I~~yk~~ys~~---~~~~~~~~~~n~~-e~ti~gL~k~TeY~~~v  591 (1381)
T KOG4221|consen  516 KVTTQPEGPVQLQAYATSPTTILVTWEPPPFGNGPITGYKLFYSED---DTGKELRVENNAT-EYTINGLEKYTEYSIRV  591 (1381)
T ss_pred             EEecCCCCCccccccccCcceEEEEecCCCCCCCCceEEEEEEEcC---CCCceEEEecCcc-EEEeecCCCccceEEEE
Confidence            778888788778888888999999999987  77899999988765   2344556667777 99999999999999999


Q ss_pred             EEEeCCCCcccceeeeeccC---CC-CCcceEEEeccCCeEEEEeecCCCC---CcceEEEEEEeCCCCCCc--eeEEee
Q psy4956         163 FSVYDSKESVAYTSRNFTTK---PN-TPGKFIVWFRNETTLLVLWQPSYPA---SIYTHYKVSIDPPDAPES--VLYVEK  233 (361)
Q Consensus       163 ~a~~~~~~s~~~~~~~~~t~---p~-~p~~l~~~~~~~~~~~v~W~~~~~~---~~~~~y~v~~~~~~~~~~--~~~~~~  233 (361)
                      .|.+..|.+..+....+.|.   |+ ||.|+++...+.++|.|+|.+|...   +.+.+|+|+|........  ..... 
T Consensus       592 vA~N~~G~g~sS~~i~V~Tlsd~PsaPP~Nl~lev~sStsVrVsW~pP~~~t~ng~itgYkIRy~~~~~~~~~~~t~v~-  670 (1381)
T KOG4221|consen  592 VAYNSAGSGVSSADITVRTLSDVPSAPPQNLSLEVVSSTSVRVSWLPPPSETQNGQITGYKIRYRKLSREDEVNETVVK-  670 (1381)
T ss_pred             EEecCCCCCCCCCceEEEeccCCCCCCCcceEEEecCCCeEEEEccCCCcccccceEEEEEEEecccCcccccceeecc-
Confidence            99999888876555555544   65 4556999999999999999876443   889999999986543322  12222 


Q ss_pred             ccCCCCCcEEEecCCCCCCeEEEEEEEEeCCCCCCceEE-EEecC--------CCCCccceEEeeecCCceEEEEeeCCC
Q psy4956         234 EGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEISTPTTA-QYRTI--------PLRPLSFTYDKASITSNSLRVVWEPPK  304 (361)
Q Consensus       234 ~~~~~~~~~~~~~~L~p~t~Y~v~V~a~~~~~~s~~~~~-~~~t~--------~~~p~~l~~~~~~~~~~si~l~W~~~~  304 (361)
                          +...++.+.+|+|++.|.|+|.|.+..|.++++.. .+.|.        |.+|..|.+   ....++|.++|++|.
T Consensus       671 ----~n~~~~l~~~Lep~T~Y~vrIsa~t~nGtGpaS~w~~aeT~~~d~~e~vp~~ps~l~~---~~g~~si~vsW~Pp~  743 (1381)
T KOG4221|consen  671 ----GNTTQYLFNGLEPNTQYRVRISAMTVNGTGPASEWVSAETPESDLDERVPGKPSELHV---HPGSNSIVVSWTPPP  743 (1381)
T ss_pred             ----cchhhhHhhcCCCCceEEEEEEEeccCCCCCcccceeccCccccccccCCCCCceeee---ccCceeEEEEeCCCC
Confidence                23578999999999999999999999988877653 44442        234454444   667789999999975


Q ss_pred             CC-CCceeEEEEEEECCCCCCCCceeecCCCCceeEeccCCCCCceEEEEEEEEeCC
Q psy4956         305 GF-SEFDKYQVSINVRRPGASSTPITKSRDEPTQCDMSEGLEPGRTYQVLVKTVSGK  360 (361)
Q Consensus       305 ~~-~~~~~y~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~p~t~Y~v~V~a~~~~  360 (361)
                      .. ..+.+|+|.|+...+. .....++++.....|.+.. |.|+..|.|+++|.+..
T Consensus       744 ~~~~~vrgY~ig~r~g~~~-p~~~tIrl~~~~s~y~l~~-Le~~~~YvVkL~AfNn~  798 (1381)
T KOG4221|consen  744 HPNIVVRGYKIGYRPGSGI-PDTGTIRLDEKVSYYNLEQ-LEPNRDYVVKLRAFNNH  798 (1381)
T ss_pred             ChhhhhcceEEeeecccCC-CCCccEEecceeeEEEEEe-cccCceEEEEEEEeccC
Confidence            42 4688999999866542 2344467788888999997 99999999999997643



>KOG4221|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>KOG1948|consensus Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>PF10342 GPI-anchored: Ser-Thr-rich glycosyl-phosphatidyl-inositol-anchored membrane family; InterPro: IPR018466 This entry represents glycoproteins involved in cell wall (1-->6)-beta-glucan assembly Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>KOG1948|consensus Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query361
1tdq_A283 Structural Basis For The Interactions Between Tenas 4e-09
3t1w_A375 Structure Of The Four-Domain Fragment Fn7b89 Of Onc 6e-09
1fnf_A368 Fragment Of Human Fibronectin Encompassing Type-Iii 3e-07
4gh7_B285 Crystal Structure Of Anticalin N7a In Complex With 2e-06
2gee_A203 Crystal Structure Of Human Type Iii Fibronectin Ext 7e-06
1fnh_A271 Crystal Structure Of Heparin And Integrin Binding S 3e-05
3r8q_A290 Structure Of Fibronectin Domain 12-14 Length = 290 4e-05
1qr4_A186 Two Fibronectin Type-Iii Domain Segment From Chicke 1e-04
>pdb|1TDQ|A Chain A, Structural Basis For The Interactions Between Tenascins And The C-Type Lectin Domains From Lecticans: Evidence For A Cross-Linking Role For Tenascins Length = 283 Back     alignment and structure

Iteration: 1

Score = 58.9 bits (141), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 75/273 (27%), Positives = 111/273 (40%), Gaps = 20/273 (7%) Query: 91 DPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLK---VISLSEKTPPRIIGFTENPPAGY 147 D PT + V S A + W+PP K LK V KT R+ + P + Y Sbjct: 16 DGPTQILVRDVSDTVAFVEWTPP-RAKVDFILLKYGLVGGEGGKTTFRL----QPPLSQY 70 Query: 148 SLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPSY 207 S++ L PG Y+V + +V + ES A +S FTT+ + P V R T+L + W S Sbjct: 71 SVQALRPGSRYEVSISAVRGTNESDA-SSTQFTTEIDAPKNLRVGSRTATSLDLEWDNSE 129 Query: 208 PASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVSEDEIS 267 + YKV + + +G P + LVPG Y + + V + S Sbjct: 130 AEA--QEYKVVYSTLAGEQYHEVLVPKGIGP-TTKTTLTDLVPGTEYGVGISAVMNSKQS 186 Query: 268 TPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKGFSEFDKYQVSINVRRPGASSTP 327 P T RT P +S TS SL +W G D Y+++ +S Sbjct: 187 IPATMNARTELDSPRDLMVTASSETSISL--IWTKASG--PIDHYRITFTPSSGISSEVT 242 Query: 328 ITKSRDEPTQCDMSEGLEPGRTYQVLVKTVSGK 360 + + R T D LEPG Y + + G+ Sbjct: 243 VPRDRTSYTLTD----LEPGAEYIISITAERGR 271
>pdb|3T1W|A Chain A, Structure Of The Four-Domain Fragment Fn7b89 Of Oncofetal Fibronectin Length = 375 Back     alignment and structure
>pdb|1FNF|A Chain A, Fragment Of Human Fibronectin Encompassing Type-Iii Repeats 7 Through 10 Length = 368 Back     alignment and structure
>pdb|4GH7|B Chain B, Crystal Structure Of Anticalin N7a In Complex With Oncofetal Fibronectin Fragment Fn7b8 Length = 285 Back     alignment and structure
>pdb|2GEE|A Chain A, Crystal Structure Of Human Type Iii Fibronectin Extradomain B And Domain 8 Length = 203 Back     alignment and structure
>pdb|1FNH|A Chain A, Crystal Structure Of Heparin And Integrin Binding Segment Of Human Fibronectin Length = 271 Back     alignment and structure
>pdb|3R8Q|A Chain A, Structure Of Fibronectin Domain 12-14 Length = 290 Back     alignment and structure
>pdb|1QR4|A Chain A, Two Fibronectin Type-Iii Domain Segment From Chicken Tenascin Length = 186 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query361
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 1e-39
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 3e-27
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 5e-37
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 5e-31
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 6e-21
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 5e-32
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 9e-32
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 7e-27
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 6e-32
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 6e-23
3r8q_A 290 Fibronectin; heparin, FNIII, heparin binding, cell 3e-15
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 3e-28
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 2e-20
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 3e-12
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 4e-28
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 4e-22
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 2e-09
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 3e-14
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 6e-09
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 4e-07
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 3e-13
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 4e-06
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 7e-13
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 3e-08
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 9e-06
2gys_A419 Cytokine receptor common beta chain; dimer of inte 8e-13
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-12
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 5e-11
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-09
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 9e-09
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 4e-12
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 9e-12
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 3e-11
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 1e-04
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 3e-11
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 4e-04
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-10
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-07
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 7e-10
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 6e-06
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 4e-05
3k2m_C101 Monobody HA4; engineered binding protein, antibody 7e-10
3k2m_C101 Monobody HA4; engineered binding protein, antibody 2e-06
3k2m_C101 Monobody HA4; engineered binding protein, antibody 3e-04
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 9e-10
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 9e-10
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 5e-09
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 5e-09
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 1e-06
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 3e-05
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 2e-08
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 3e-07
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 4e-05
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 2e-08
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 8e-08
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 8e-08
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-05
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 8e-08
3l5i_A 290 Interleukin-6 receptor subunit beta; cytokine rece 3e-04
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 9e-08
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 2e-05
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 2e-04
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 2e-07
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 2e-06
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 6e-04
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 2e-07
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 1e-06
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 2e-07
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 5e-06
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 1e-05
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 7e-07
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 1e-05
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 1e-06
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 2e-06
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 1e-06
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 1e-05
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 6e-04
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 1e-06
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 2e-06
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 6e-05
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 2e-06
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 6e-04
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 3e-06
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 6e-05
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 3e-04
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 3e-06
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 3e-06
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 5e-04
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 3e-06
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 5e-06
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 8e-06
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 3e-04
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 1e-05
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 2e-04
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 1e-05
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 1e-05
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 1e-05
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 2e-05
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 1e-04
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 2e-05
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 3e-05
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 4e-05
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 4e-04
3t04_D103 Monobody 7C12; engineered binding protein, antibod 4e-05
3t04_D103 Monobody 7C12; engineered binding protein, antibod 1e-04
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 7e-05
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 3e-04
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 5e-04
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 6e-04
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 7e-04
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 9e-04
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
 Score =  141 bits (356), Expect = 1e-39
 Identities = 65/277 (23%), Positives = 102/277 (36%), Gaps = 14/277 (5%)

Query: 83  TASITTPPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRIIGFTEN 142
                   D PT + V   S   A + W+PP   K     LK   +  +           
Sbjct: 8   GGGGIPVIDGPTQILVRDVSDTVAFVEWTPP-RAKVDFILLKYGLVGGEGGKTTFRLQPP 66

Query: 143 PPAGYSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVL 202
               YS++ L PG  Y+V + +V  + ES A +S  FTT+ + P    V  R  T+L + 
Sbjct: 67  LSQ-YSVQALRPGSRYEVSISAVRGTNESDA-SSTQFTTEIDAPKNLRVGSRTATSLDLE 124

Query: 203 WQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVS 262
           W      +    YKV        +    +  +G  P   +     LVPG  Y + +  V 
Sbjct: 125 WDN--SEAEAQEYKVVYSTLAGEQYHEVLVPKGIGP-TTKTTLTDLVPGTEYGVGISAVM 181

Query: 263 EDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKGFSEFDKYQVSINVRRPG 322
             + S P T   RT    P        + +  S+ ++W    G    D Y+++       
Sbjct: 182 NSKQSIPATMNARTELDSPRDLMVT--ASSETSISLIWTKASG--PIDHYRIT--FTPSS 235

Query: 323 ASSTPITKSRDEPTQCDMSEGLEPGRTYQVLVKTVSG 359
             S+ +T  RD  +       LEPG  Y + +    G
Sbjct: 236 GISSEVTVPRDRTSYTL--TDLEPGAEYIISITAERG 270


>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query361
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 100.0
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 100.0
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 100.0
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 100.0
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 100.0
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 100.0
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 100.0
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 100.0
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 100.0
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 100.0
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 100.0
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 100.0
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.97
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 99.97
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.97
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.97
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.96
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.96
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.95
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.94
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.93
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.92
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 99.92
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.91
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.91
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.91
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.91
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.9
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.9
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.9
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.9
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.9
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.9
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.9
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.88
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.88
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.87
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.87
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.87
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.87
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.87
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.87
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.87
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.87
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.86
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.85
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.84
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.83
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.83
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.83
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.81
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.8
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.8
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.79
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.79
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.78
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.78
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.77
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.76
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.75
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.74
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.69
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.67
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.66
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.66
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.65
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 99.65
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.63
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.63
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.62
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.6
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.6
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.57
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.57
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.55
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.55
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.54
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.54
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.53
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.52
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.51
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.51
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.5
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.5
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.49
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.49
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.49
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.49
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.48
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.48
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 99.48
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.48
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.47
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.47
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.47
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.46
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.46
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.46
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.45
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.44
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.44
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.43
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.43
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.43
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.43
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.42
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.42
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.42
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.42
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.42
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.42
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 99.42
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.42
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.41
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.41
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 99.41
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.41
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.41
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.41
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.41
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.41
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.41
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.4
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.4
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.4
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.4
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.4
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.4
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.4
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.39
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.39
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.39
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.39
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.38
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.38
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.38
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.38
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.38
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.37
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.37
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.37
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.37
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 99.37
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.37
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.37
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.36
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 99.36
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 99.36
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.36
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.35
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.35
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.35
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.35
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.35
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.35
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.34
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.34
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.34
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.34
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.33
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.33
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 99.33
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.33
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.33
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.33
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.33
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.33
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.33
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.32
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.32
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.31
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.31
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.31
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.31
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.31
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.31
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.3
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 99.3
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.3
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.3
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.29
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.29
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.29
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.29
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.29
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.29
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.29
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.28
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.28
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.28
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.28
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.27
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.27
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.27
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.27
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.27
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.26
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.25
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.25
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.25
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.25
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.25
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.24
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.24
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.24
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.24
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.24
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.24
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.24
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.23
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.22
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.22
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.22
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.21
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.21
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.21
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 99.2
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.2
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.2
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.2
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.2
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.2
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.19
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.18
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.18
2erj_C247 Cytokine receptor common gamma chain; immune syste 99.18
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.15
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.15
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.15
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.14
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.14
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.14
2erj_C247 Cytokine receptor common gamma chain; immune syste 99.14
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.13
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 99.12
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.12
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.11
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.11
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 99.09
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.09
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.09
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.09
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 99.07
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.04
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 99.03
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 98.99
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 98.98
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 98.97
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 98.95
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 98.94
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 98.93
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 98.92
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 98.92
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 98.91
1oww_A98 FN, fibronectin first type III module, CIG; fibron 98.88
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 98.87
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 98.86
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 98.84
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 98.83
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 98.82
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 98.82
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 98.78
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 98.75
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 98.73
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 98.7
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 98.69
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 98.68
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 98.67
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 98.61
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 98.6
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 98.53
1oww_A98 FN, fibronectin first type III module, CIG; fibron 98.51
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 98.51
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 98.44
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 98.42
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 98.29
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 98.18
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 98.01
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 97.98
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 97.95
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 97.92
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 97.88
3b4n_A344 Endo-pectate lyase; pectin, galacturonic acid, rig 97.15
3b4n_A 344 Endo-pectate lyase; pectin, galacturonic acid, rig 96.79
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 96.54
3bes_R250 Interferon-gamma binding protein C4R; orthopoxviru 96.49
3bes_R250 Interferon-gamma binding protein C4R; orthopoxviru 96.28
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 95.91
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 95.69
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 95.53
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 95.44
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 95.35
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 95.18
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 95.17
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 93.52
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 90.11
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 87.84
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 87.18
4gns_A290 Chitin biosynthesis protein CHS5; FN3, BRCT, tetra 84.98
4gns_A 290 Chitin biosynthesis protein CHS5; FN3, BRCT, tetra 83.87
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 83.15
4a2l_A795 BT_4663, two-component system sensor histidine kin 82.84
3ott_A758 Two-component system sensor histidine kinase; beta 82.61
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 82.34
2e7m_A113 Protein KIAA0319; PKD domain, structural genomics, 81.0
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
Probab=100.00  E-value=1.1e-42  Score=304.52  Aligned_cols=336  Identities=21%  Similarity=0.327  Sum_probs=266.7

Q ss_pred             ceEEEEecCCCCCCCcceEEEEEEcCCCCCCCCeEEeecCccceEEecCCCCCceEEEEEEEecCCcCccceeeEEEecC
Q psy4956          10 GANLVIKIPENLSSDNSTYRLDYIPAHGHPPPNTTYVSRDIKDNIEFSEGLPGTKYDFYLYYTNSTVHDWLTWTASITTP   89 (361)
Q Consensus        10 ~~~l~~~~p~~~~~~~~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~i~V~a~~~~~~~~~~~~~~~~t~   89 (361)
                      ...|.|+.|..  +.+.+|+|+|+..++............+.+++.|.+|.|++.|.|+|+|.++. +.+.+........
T Consensus        19 sv~l~W~~~~~--~~~~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~~~V~a~~~~-g~s~~~~~~~~~~   95 (375)
T 3t1w_A           19 VLTVSWERSTT--PDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDD-KESVPISDTIIPE   95 (375)
T ss_dssp             EEEEEEECCSC--SSCCEEEEEEEETTCTTSCCEEEEEETTCCEEEECCCCTTCCEEEEEEEEETT-EECCCEEEEECCC
T ss_pred             EEEEEEeCCCC--CCeeeEEEEEEECCCCCCcceeEEcCCCccEEEEcCCcCCCEEEEEEEEEcCC-CCCCcEEeeEcCC
Confidence            56666666644  57999999999866543223333333447999999999999999999999877 4455555555555


Q ss_pred             CCCCCccEEEEEeCCEEEEEeeCCCCCCcccEEEEEEECCCCCCCeEEeecCCCCceEEEcCCCCCcEEEEEEEEEeCCC
Q psy4956          90 PDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRIIGFTENPPAGYSLKDLTPGGSYQVQLFSVYDSK  169 (361)
Q Consensus        90 ~~~p~~l~~~~~~~~~v~l~W~~p~~~~~~~y~v~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~p~~~Y~v~v~a~~~~~  169 (361)
                      +.+|.++.+...+.+++.|+|+++.++.+.+|+|+|+..+.........+..... .+.|.+|.|++.|.|+|+|.+..|
T Consensus        96 ~p~p~~l~~~~~~~~si~l~W~~~~~~~i~~Y~v~~~~~~~~~~~~~~~~~~~~~-~~~i~~L~p~t~Y~~~V~a~~~~g  174 (375)
T 3t1w_A           96 VPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVG-YYTVTGLEPGIDYDISVITLINGG  174 (375)
T ss_dssp             CCCCSCCEEECCCSSEEEEECCCCCCTTEEEEEEEEEESSSCCSCEEEEECTTCC-EEEEECCCTTCEEEEEEEEEETTE
T ss_pred             CCCCceEEEEecCCCeEEEEEECCCCCCceEEEEEEEECCCCCceeEEEcCCCcc-eEEEeCCCCCCEEEEEEEEEeCCc
Confidence            5568999999989999999999987678999999998865544445555666666 999999999999999999999998


Q ss_pred             CcccceeeeeccCCCCCcceEEEeccCCeEEEEeecCCCCCcceEEEEEEeCCCCCCceeEEeeccCCCCCcEEEecCCC
Q psy4956         170 ESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLV  249 (361)
Q Consensus       170 ~s~~~~~~~~~t~p~~p~~l~~~~~~~~~~~v~W~~~~~~~~~~~y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~  249 (361)
                      .+.+.. ....+.+.+|.++.+...+.+++.|+|+++. .+.+.+|.|.|...+..........   ......+.+.+|.
T Consensus       175 ~s~~s~-~~~~t~~~~p~~l~~~~~~~~si~l~W~~p~-~~~i~~Y~v~~~~~~~~~~~~~~~~---~~~~~~~~i~~L~  249 (375)
T 3t1w_A          175 ESAPTT-LTQQTAVPPPTDLRFTNIGPDTMRVTWAPPP-SIDLTNFLVRYSPVKNEEDVAELSI---SPSDNAVVLTNLL  249 (375)
T ss_dssp             ECCCEE-EEEECCCCCCEEEEEESCCSSCEEEEEECCS-SCCCCEEEEEEEEGGGTTCCEEEEE---CTTCCEEEECSCC
T ss_pred             ccCCee-eeeecCCCCCceeEEEecccCEEEEEEcCCC-CCCccEEEEEEEeCCCCCCcEEEEc---CCCcCEEEeCCCC
Confidence            887644 4445566689999999899999999999873 4678999999987654322211211   2335899999999


Q ss_pred             CCCeEEEEEEEEeCCCCCCceEEEEecCCCCCccceEEeeecCCceEEEEeeCCCCCCCceeEEEEEEECCCCCCCCcee
Q psy4956         250 PGRAYNISVQTVSEDEISTPTTAQYRTIPLRPLSFTYDKASITSNSLRVVWEPPKGFSEFDKYQVSINVRRPGASSTPIT  329 (361)
Q Consensus       250 p~t~Y~v~V~a~~~~~~s~~~~~~~~t~~~~p~~l~~~~~~~~~~si~l~W~~~~~~~~~~~y~i~~~~~~~~~~~~~~~  329 (361)
                      |++.|.|+|+|.+..|.+.+......+.|.+|.++.+  ..++.+++.|+|++|.+  .+.+|.|.|...+... .....
T Consensus       250 p~t~Y~~~V~A~~~~g~s~~~~~~~~t~p~~P~~l~~--~~~~~~sv~l~W~~p~~--~~~~Y~v~~~~~~~~~-~~~~~  324 (375)
T 3t1w_A          250 PGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDF--SDITANSFTVHWIAPRA--TITGYRIRHHPEHFSG-RPRED  324 (375)
T ss_dssp             TTCEEEEEEEEEETTEECCCEEEEEECCCCCCEEEEE--ESCCSSCEEEEEECCSS--CCSEEEEEEEETTCCS-SCEEE
T ss_pred             CCCEEEEEEEEEcCCCcCCceeeEEecCCCCCCccEe--eeccCCEEEEEECCCCc--ceeeEEEEEEECCCCC-cceeE
Confidence            9999999999999999999988888999999999999  88899999999999876  8999999999876411 22223


Q ss_pred             ecCCCCceeEeccCCCCCceEEEEEEEEeCC
Q psy4956         330 KSRDEPTQCDMSEGLEPGRTYQVLVKTVSGK  360 (361)
Q Consensus       330 ~~~~~~~~~~~~~~L~p~t~Y~v~V~a~~~~  360 (361)
                      ......+++.+.+ |+||+.|.|+|+|+++.
T Consensus       325 ~~~~~~~~~~i~~-L~p~t~Y~~~V~A~~~~  354 (375)
T 3t1w_A          325 RVPHSRNSITLTN-LTPGTEYVVSIVALNGR  354 (375)
T ss_dssp             EEETTCCEEEECS-CCTTCEEEEEEEEEETT
T ss_pred             EcCCCccEEEECC-CCCCCEEEEEEEEECCC
Confidence            3456678999986 99999999999999864



>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>2e7m_A Protein KIAA0319; PKD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 361
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 5e-06
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 8e-05
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 2e-04
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 0.004
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 3e-04
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 6e-04
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 7e-04
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 0.001
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 0.001
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 0.001
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 0.003
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 0.001
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 0.002
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 0.002
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 0.002
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 0.002
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 0.002
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 0.002
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 0.003
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 0.003
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 0.003
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 0.004
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 0.004
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Receptor-type tyrosine-protein phosphatase delta, PTPRD
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.8 bits (100), Expect = 5e-06
 Identities = 21/96 (21%), Positives = 32/96 (33%), Gaps = 3/96 (3%)

Query: 87  TTPPDPPTNLSVNVRSGKTAQIFWSPPISGKYSGFKLKVISLSEKTPPRIIGFTENPPAG 146
           T  P  P N      S  +  + W+PP S   + ++L           RI   T  P   
Sbjct: 8   TGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHGEEQRI---TIEPGTS 64

Query: 147 YSLKDLTPGGSYQVQLFSVYDSKESVAYTSRNFTTK 182
           Y L+ L P   Y  +L +        +    +  T 
Sbjct: 65  YRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTM 100


>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query361
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.64
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.58
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.57
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.56
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.55
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.54
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.53
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.52
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.51
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.51
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.5
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.5
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.5
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.5
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.49
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.49
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.49
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.49
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.48
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.48
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.47
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.47
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.47
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.46
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.46
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.46
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.46
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.45
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.45
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.45
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.44
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.44
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.43
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.43
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.43
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.43
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.42
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.41
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.41
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.41
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.4
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.39
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.39
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.39
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.38
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.38
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.37
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.36
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.36
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.36
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.36
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.35
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.35
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.35
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.34
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.34
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.34
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.34
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.33
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.33
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.32
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.31
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.31
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.3
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.3
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.3
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.3
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.29
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.29
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.29
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.29
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.29
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.28
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.28
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.27
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.27
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.27
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.26
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.26
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.26
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.26
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2crza197 Fibronectin type-III domain containing protein 3a, 99.25
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.25
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.24
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.22
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.22
d2crza197 Fibronectin type-III domain containing protein 3a, 99.22
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.21
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.19
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.19
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.18
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.18
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.18
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.18
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.17
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.15
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.15
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.15
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.14
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.13
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.13
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.12
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.12
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.12
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.11
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.11
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.11
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.11
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.11
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.11
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 99.11
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.11
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.1
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.09
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.09
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.07
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.07
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.07
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.06
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.05
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.04
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.04
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.02
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.01
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.01
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.99
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 98.98
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 98.97
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.96
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 98.96
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 98.95
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 98.94
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 98.94
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 98.93
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.92
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.92
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.87
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 98.83
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.83
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.78
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 98.73
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.71
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.7
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.67
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.62
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.57
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.51
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 97.63
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 96.96
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 96.82
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 96.64
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 96.59
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 96.48
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 96.24
d2hfta1106 Extracellular region of human tissue factor {Human 96.05
d1a21a1103 Extracellular region of human tissue factor {Rabbi 96.0
d2c4fu1116 Extracellular region of human tissue factor {Human 95.27
d2hfta1106 Extracellular region of human tissue factor {Human 94.89
d2c4fu1116 Extracellular region of human tissue factor {Human 94.65
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 94.44
d1a21a1103 Extracellular region of human tissue factor {Rabbi 93.63
d1axib199 Growth hormone receptor {Human (Homo sapiens) [Tax 90.66
d2gysa399 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 86.26
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Tenascin-X
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.64  E-value=9.2e-16  Score=105.28  Aligned_cols=101  Identities=17%  Similarity=0.322  Sum_probs=85.7

Q ss_pred             CCCCcceEEEeccCCeEEEEeecCCCCCcceEEEEEEeCCCCCCceeEEeeccCCCCCcEEEecCCCCCCeEEEEEEEEe
Q psy4956         183 PNTPGKFIVWFRNETTLLVLWQPSYPASIYTHYKVSIDPPDAPESVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTVS  262 (361)
Q Consensus       183 p~~p~~l~~~~~~~~~~~v~W~~~~~~~~~~~y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~p~t~Y~v~V~a~~  262 (361)
                      |.+|.+|.+...+.+++.|+|+++  .+.+.+|.|.|...++........     ...+.+.|.+|.|++.|.|+|+|++
T Consensus         1 P~~P~~l~~~~~t~~si~l~W~~p--~~~i~~Y~v~~~~~~~~~~~~~~~-----~~~~~~~l~~L~p~t~Y~~~V~a~~   73 (102)
T d2cuha1           1 PDGPTQLRALNLTEGFAVLHWKPP--QNPVDTYDIQVTAPGAPPLQAETP-----GSAVDYPLHDLVLHTNYTATVRGLR   73 (102)
T ss_dssp             CSSCEEEECCCCSSSCEEEEEECC--SSCCSEEEEEEECSSSCCEEEEEE-----TTCSEEEECSCCSSSEEEEEEEEEE
T ss_pred             CcCCCccEEEEeCCCEEEEEEEee--eccceeeEEEEEeccccceeeeee-----eeeeeEEEccEEeeEEEEEEEEEEe
Confidence            678999999999999999999987  467899999999876655444433     2358999999999999999999999


Q ss_pred             CCCCCCceEEEEecCCCCCccceEEeeecC
Q psy4956         263 EDEISTPTTAQYRTIPLRPLSFTYDKASIT  292 (361)
Q Consensus       263 ~~~~s~~~~~~~~t~~~~p~~l~~~~~~~~  292 (361)
                      +.+.+.+....+.|.+.+|.+|.+  ..++
T Consensus        74 ~~~~s~~~~~~~~T~~~~P~~l~~--~~vt  101 (102)
T d2cuha1          74 GPNLTSPASITFTTGLEAPRDLEA--KEVT  101 (102)
T ss_dssp             TTEECCCEEEEEESCCCCTTTSSS--CCCC
T ss_pred             CCCCcCCEEEEEECCCCCCCCCEe--ecCC
Confidence            999999998899999999999888  5443



>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa3 b.1.2.1 (A:218-316) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure