Diaphorina citri psyllid: psy4957


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MNSALQQVKVNLTWDETDPDRVEAVSKLMSGDVDEANLKTYLATSSEEEGKRDFLFYLREKLNDNIWADGFNIDPELIRDYFYRFLYQPQDREYPDLCQLPDLNETTLLENLRARFNAGHIYTYVGSILIAVNPFKLFFCEDV
cccccccEEEEccccccccHHHHHHHHHccccccccccEEEEcccccccccccEEEEEEEcccccCEEcccccccEEEEEccccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEccEEEEEccccccccccc
***************ET**DR******LMSGDVDEANLKTYLATSSEEEGKRDFLFYLREKLNDNIWADGFNIDPELIRDYFYRFLYQPQDREYPDLCQLPDLNETTLLENLRARFNAGHIYTYVGSILIAVNPFKLFFCEDV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSALQQVKVNLTWDETDPDRVEAVSKLMSGDVDEANLKTYLATSSEEEGKRDFLFYLREKLNDNIWADGFNIDPELIRDYFYRFLYQPQDREYPDLCQLPDLNETTLLENLRARFNAGHIYTYVGSILIAVNPFKLFFCEDV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Unconventional myosin-IXa Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Regulates Rho activity in neurons, has a role in the regulation of neuronal morphology and function.confidentB2RTY4
Unconventional myosin-IXa Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Regulates Rho by stimulating it's GTPase activity in neurons, has a role in the regulation of neuronal morphology and function.confidentQ9Z1N3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0033275 [BP]actin-myosin filament slidingprobableGO:0030029, GO:0009987, GO:0006928, GO:0030048, GO:0044763, GO:0008150, GO:0070252, GO:0044699
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0060002 [MF]plus-end directed microfilament motor activityprobableGO:0016787, GO:0016818, GO:0000146, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674, GO:0003774

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W9I, chain A
Confidence level:very confident
Coverage over the Query: 52-142
View the alignment between query and template
View the model in PyMOL