Diaphorina citri psyllid: psy4974


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-----
MDQVNPSKRLSGGVFLCSFDFIPRTMSGKVKRKDLVKKILENQGSQKTYGLQETLLDTQLPSRTDFIHQDVFTEGFFSIKGCDIRFIKYGSGAQVLFFTYGVLGEIRNSFKKQLTAFDPKLFTSIFWDPPGNVVLYLLGKTCSGYGQSLPKGRSFVPFQYIEEDVDIAYELLKLLGVCKVSLFGWCDGGHLSFVFSMKYPHMVHKLVIWGTKSFLTIDNVRVFEGMRRLSNWSPMARSEVLKAYDNDVNYITGIFNQYVDMVNLIFKSYGRNVYQELLPYVDVPVLVFHSADDVMVSTQQVQSLLNQLKFCQYYQFSSGGHSCHIKHGQVFNEISRNFILEENKT
cccccccccccccEEEEECcccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEEEccEEEEEEECcccccEEEEEccccccHHHHHHHHHHHHcccccEEEEEccccccHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEECcHHHHHHHHHHHHccccccEEEEEcccccccccHHHHHHHHHHcccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEcccccccHHHHHHHHHcccccEEEEEccccccHHcccHHHHHHHHHHHHcccccc
**********SGGVFLCSFDFIPRTMSGKVKRKDLVKKILENQG*QKTYGLQETLLDTQLPSRTDFIHQDVFTEGFFSIKGCDIRFIKYGSGAQVLFFTYGVLGEIRNSFKKQLTAFDPKLFTSIFWDPPGNVVLYLLGKTCSGYGQSLPKGRSFVPFQYIEEDVDIAYELLKLLGVCKVSLFGWCDGGHLSFVFSMKYPHMVHKLVIWGTKSFLTIDNVRVFEGMRRLSNWSPMARSEVLKAYDNDVNYITGIFNQYVDMVNLIFKSYGRNVYQELLPYVDVPVLVFHSADDVMVSTQQVQSLLNQLKFCQYYQFSSGGHSCHIKHGQVFNEISRNFILEE***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQVNPSKRLSGGVFLCSFDFIPRTMSGKVKRKDLVKKILENQGSQKTYGLQETLLDTQLPSRTDFIHQDVFTEGFFSIKGCDIRFIKYGSGAQVLFFTYGVLGEIRNSFKKQLTAFDPKLFTSIFWDPPGNVVLYLLGKTCSGYGQSLPKGRSFVPFQYIEEDVDIAYELLKLLGVCKVSLFGWCDGGHLSFVFSMKYPHMVHKLVIWGTKSFLTIDNVRVFEGMRRLSNWSPMARSEVLKAYDNDVNYITGIFNQYVDMVNLIFKSYGRNVYQELLPYVDVPVLVFHSADDVMVSTQQVQSLLNQLKFCQYYQFSSGGHSCHIKHGQVFNEISRNFILEENKT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Valacyclovir hydrolase Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol.confidentQ8R164
Valacyclovir hydrolase Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol.confidentQ86WA6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OCG, chain A
Confidence level:very confident
Coverage over the Query: 72-131,145-340
View the alignment between query and template
View the model in PyMOL
Template: 3RIX, chain A
Confidence level:probable
Coverage over the Query: 12-37
View the alignment between query and template
View the model in PyMOL