Diaphorina citri psyllid: psy5002

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------

MVLKYRKPTLIQGGRLDPALPLFSSNITGRLDSTDATFVDIIHTCGGYLGYYQPCGHVDFYPNGGTFIQPGCGWDIVHAYTTQQPGNKEAKNDGQCRTEEKIYLVLTGFVLSVHIYQTKIGFYARQCNSWSDYKKGHCKGSVEDMILMAYLELHDYNIICVDWSNLASNRLYPLARWTIKYIGQHLADMLTTIERTTGYDWCMFHLVGHSLGAHVCGIAGENIAHGKIGRITGLDPALPLFSSNITGRLDSTDATFVDIIHTCGGYLGYYQPCGHVDFYPNGGTFIQPGCGWDIGTCSHTRSYMFFTESIRTKIGFYARQCNSWSDYKKGHCKGSVEDMILMGEHVNTSARGKYYLMTASSKPYALGRYFPQPKHDTFPSSRGQLRGHLRTYRKYVNSVLIKEAKRIGYKMALLSNT

ccccccccccccEECccccccccccccccccccccccccEEEEEcccccccccccccCEECccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccEEEEEEcccccccccHHHHHHcHHHHHHHHHHHHHHHHHHcccccccEEEEEECcHHHHHHHccccccccccccEEEEcccccccccccccccccccccccEEEEEcccccccccccccEEECccccccccccccccccccccHHHHHHHHHHccccccEEEEEcccHHHHHcccccccccccccccccccccccEEEEEEccccccccccccccccccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHcccc

***K***PTLIQGGRLDPALPLFSSNITGRLDSTDATFVDIIHTCGGYLGYYQPCGHVDFYPNGGTFIQPGCGWDIVHAYTTQQPGNKEAKNDGQCRTEEKIYLVLTGFVLSVHIYQTKIGFYARQCNSWSDYKKGHCKGSVEDMILMAYLELHDYNIICVDWSNLASNRLYPLARWTIKYIGQHLADMLTTIERTTGYDWCMFHLVGHSLGAHVCGIAGENIAHGKIGRITGLDPALPLFSSNITGRLDSTDATFVDIIHTCGGYLGYYQPCGHVDFYPNGGTFIQPGCGWDIGTCSHTRSYMFFTESIRTKIGFYARQCNSWSDYKKGHCKGSVEDMILMGEHVNTSARGKYYLMTASSKPYALGRYFPQPKHDTFPSSRGQLRGHLRTYRKYVNSVLIKEAKRIGYKMALLS**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0004620 [MF]	phospholipase activity	probable	GO:0016787, GO:0003674, GO:0016298, GO:0016788, GO:0003824
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016042 [BP]	lipid catabolic process	probable	GO:0044238, GO:1901575, GO:0006629, GO:0044710, GO:0071704, GO:0008150, GO:0008152, GO:0009056

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HPL, chain A
Confidence level:very confident
Coverage over the Query: 142-369
View the alignment between query and template
View the model in PyMOL

Template: 1BU8, chain A
Confidence level:very confident
Coverage over the Query: 6-142
View the alignment between query and template
View the model in PyMOL

Template: 2OXE, chain A
Confidence level:confident
Coverage over the Query: 151-390
View the alignment between query and template
View the model in PyMOL