Psyllid ID: psy5002
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 417 | 2.2.26 [Sep-21-2011] | |||||||
| Q9WVG5 | 500 | Endothelial lipase OS=Mus | no | N/A | 0.527 | 0.44 | 0.362 | 3e-31 | |
| Q6XZB0 | 460 | Lipase member I OS=Homo s | yes | N/A | 0.429 | 0.389 | 0.417 | 5e-31 | |
| Q64425 | 457 | Pancreatic triacylglycero | N/A | N/A | 0.434 | 0.396 | 0.384 | 3e-30 | |
| Q8WWY8 | 451 | Lipase member H OS=Homo s | no | N/A | 0.537 | 0.496 | 0.344 | 3e-30 | |
| Q5XGE9 | 460 | Lipase member H OS=Xenopu | no | N/A | 0.527 | 0.478 | 0.346 | 3e-30 | |
| Q29524 | 478 | Lipoprotein lipase OS=Ovi | N/A | N/A | 0.534 | 0.466 | 0.361 | 3e-30 | |
| P11151 | 478 | Lipoprotein lipase OS=Bos | yes | N/A | 0.534 | 0.466 | 0.361 | 3e-30 | |
| Q8CIV3 | 451 | Lipase member H OS=Mus mu | no | N/A | 0.539 | 0.498 | 0.325 | 5e-30 | |
| Q9Y5X9 | 500 | Endothelial lipase OS=Hom | no | N/A | 0.508 | 0.424 | 0.357 | 5e-30 | |
| P49060 | 475 | Lipoprotein lipase OS=Pap | N/A | N/A | 0.534 | 0.469 | 0.357 | 5e-30 |
| >sp|Q9WVG5|LIPE_MOUSE Endothelial lipase OS=Mus musculus GN=Lipg PE=2 SV=3 | Back alignment and function desciption |
|---|
Score = 136 bits (342), Expect = 3e-31, Method: Compositional matrix adjust.
Identities = 90/248 (36%), Positives = 129/248 (52%), Gaps = 28/248 (11%)
Query: 147 LMAYLELH--DYNIICVDWSNLASNRLYPLARWTIKYIGQHLADMLTTIERTTGYDWCMF 204
L++ L++ D N++ VDW LA ++LY A + +GQ +A ML ++ +
Sbjct: 105 LVSALQMREKDANVVVVDWLPLA-HQLYTDAVNNTRVVGQRVAGMLDWLQEKEEFSLGNV 163
Query: 205 HLVGHSLGAHVCGIAGENIAHGKIGRITGLDPALPLFSS-NITGRLDSTDATFVDIIHT- 262
HL+G+SLGAHV G AG N G +GRITGLDPA P+F +I RL DA FVD++HT
Sbjct: 164 HLIGYSLGAHVAGYAG-NFVKGTVGRITGLDPAGPMFEGVDINRRLSPDDADFVDVLHTY 222
Query: 263 ---CGGYLGYYQPCGHVDFYPNGGTFIQPGCGWD--IGT-----------CSHTRSYMFF 306
G +G P GH+D YPNGG F QPGCG++ IG+ C H R+ F
Sbjct: 223 TLSFGLSIGIRMPVGHIDIYPNGGDF-QPGCGFNDVIGSFAYGTISEMVKCEHERAVHLF 281
Query: 307 TES-IRTKIGFYARQCNSWSDYKKGHC----KGSVEDMILMGEHVNTSARGKYYLMTASS 361
+S + +A QC S +K+G C K ++ + + K YL T +
Sbjct: 282 VDSLVNQDKPSFAFQCTDSSRFKRGICLSCRKNRCNNIGYNAKKMRKKRNSKMYLKTRAG 341
Query: 362 KPYALGRY 369
P+ + Y
Sbjct: 342 MPFKVYHY 349
|
Has phospholipase and triglyceride lipase activities. Hydrolyzes high density lipoproteins (HDL) more efficiently than other lipoproteins. Binds heparin. Mus musculus (taxid: 10090) EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 3 |
| >sp|Q6XZB0|LIPI_HUMAN Lipase member I OS=Homo sapiens GN=LIPI PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q64425|LIPP_MYOCO Pancreatic triacylglycerol lipase (Fragment) OS=Myocastor coypus GN=PNLIP PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8WWY8|LIPH_HUMAN Lipase member H OS=Homo sapiens GN=LIPH PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q5XGE9|LIPH_XENTR Lipase member H OS=Xenopus tropicalis GN=liph PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q29524|LIPL_SHEEP Lipoprotein lipase OS=Ovis aries GN=LPL PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P11151|LIPL_BOVIN Lipoprotein lipase OS=Bos taurus GN=LPL PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8CIV3|LIPH_MOUSE Lipase member H OS=Mus musculus GN=Liph PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9Y5X9|LIPE_HUMAN Endothelial lipase OS=Homo sapiens GN=LIPG PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P49060|LIPL_PAPAN Lipoprotein lipase OS=Papio anubis GN=LPL PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 417 | ||||||
| 383850458 | 315 | PREDICTED: pancreatic triacylglycerol li | 0.510 | 0.676 | 0.504 | 1e-54 | |
| 156547651 | 357 | PREDICTED: pancreatic lipase-related pro | 0.520 | 0.607 | 0.482 | 7e-53 | |
| 380011769 | 358 | PREDICTED: pancreatic triacylglycerol li | 0.517 | 0.603 | 0.493 | 1e-52 | |
| 328787797 | 314 | PREDICTED: pancreatic triacylglycerol li | 0.517 | 0.687 | 0.497 | 1e-52 | |
| 307204858 | 323 | Pancreatic triacylglycerol lipase [Harpe | 0.669 | 0.863 | 0.4 | 4e-52 | |
| 383853802 | 322 | PREDICTED: pancreatic triacylglycerol li | 0.613 | 0.795 | 0.422 | 2e-51 | |
| 357605041 | 350 | pancreatic triacylglycerol lipase [Danau | 0.556 | 0.662 | 0.483 | 7e-51 | |
| 307189194 | 315 | Pancreatic triacylglycerol lipase [Campo | 0.522 | 0.692 | 0.478 | 7e-51 | |
| 332017029 | 358 | Pancreatic triacylglycerol lipase [Acrom | 0.513 | 0.597 | 0.488 | 7e-51 | |
| 380011243 | 321 | PREDICTED: pancreatic triacylglycerol li | 0.520 | 0.676 | 0.464 | 1e-50 |
| >gi|383850458|ref|XP_003700812.1| PREDICTED: pancreatic triacylglycerol lipase-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 219 bits (559), Expect = 1e-54, Method: Compositional matrix adjust.
Identities = 112/222 (50%), Positives = 147/222 (66%), Gaps = 9/222 (4%)
Query: 150 YLELHDYNIICVDWSNLASNRLYPLARWTIKYIGQHLADMLTTIERTTGYDWCMFHLVGH 209
YL+ +D+N+I VDW LA++ Y + +G+ A+ + + TG H +GH
Sbjct: 87 YLKHNDFNVIMVDWQPLAASTFYLGPMRNTEKVGKTAAEFIDFLAAETGLKTKNIHFLGH 146
Query: 210 SLGAHVCGIAGENIAHGKIGRITGLDPALP---LFSSNITGRLDSTDATFVDIIHTCGGY 266
SLGAHV G AG ++ G +GRITGLDPALP LF+S+ T RLDSTDA FVDIIH+CGG
Sbjct: 147 SLGAHVAGNAGSSVTSGALGRITGLDPALPGVHLFTSDKT-RLDSTDALFVDIIHSCGGV 205
Query: 267 LGYYQPCGHVDFYPNGGTFIQPGC---GWDIGTCSHTRSYMFFTESIRTKIGFYARQCNS 323
LG+ QP G VDFYPN GT +QPGC I +CSH R+Y++FTESI +KIGF A QCN+
Sbjct: 206 LGFLQPLGSVDFYPNAGTAVQPGCCCLPEVIESCSHGRAYVYFTESIGSKIGFRAHQCNT 265
Query: 324 WSDYKKGHCKGSVEDMILMGEHVNTSARGKYYLMTASSKPYA 365
W + +G C + + LMGEHV+ +A G Y+L T S P+A
Sbjct: 266 WDQFMQGSCDQT--KVALMGEHVDETATGTYFLRTRSEPPFA 305
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|156547651|ref|XP_001604261.1| PREDICTED: pancreatic lipase-related protein 2-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|380011769|ref|XP_003689968.1| PREDICTED: pancreatic triacylglycerol lipase-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328787797|ref|XP_003251004.1| PREDICTED: pancreatic triacylglycerol lipase-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|307204858|gb|EFN83416.1| Pancreatic triacylglycerol lipase [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|383853802|ref|XP_003702411.1| PREDICTED: pancreatic triacylglycerol lipase-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|357605041|gb|EHJ64444.1| pancreatic triacylglycerol lipase [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|307189194|gb|EFN73642.1| Pancreatic triacylglycerol lipase [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332017029|gb|EGI57828.1| Pancreatic triacylglycerol lipase [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|380011243|ref|XP_003689720.1| PREDICTED: pancreatic triacylglycerol lipase-like [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 417 | ||||||
| FB|FBgn0031976 | 389 | CG7367 [Drosophila melanogaste | 0.549 | 0.588 | 0.419 | 7.3e-43 | |
| FB|FBgn0034166 | 394 | CG6472 [Drosophila melanogaste | 0.553 | 0.586 | 0.404 | 1e-36 | |
| FB|FBgn0032612 | 484 | CG13282 [Drosophila melanogast | 0.525 | 0.452 | 0.394 | 1.3e-36 | |
| FB|FBgn0039471 | 338 | CG6295 [Drosophila melanogaste | 0.556 | 0.686 | 0.374 | 3.5e-36 | |
| FB|FBgn0031426 | 372 | CG18641 [Drosophila melanogast | 0.527 | 0.591 | 0.375 | 9.2e-36 | |
| FB|FBgn0039475 | 341 | CG6277 [Drosophila melanogaste | 0.529 | 0.648 | 0.384 | 4e-35 | |
| UNIPROTKB|P49923 | 478 | LPL "Lipoprotein lipase" [Sus | 0.443 | 0.387 | 0.37 | 6.8e-35 | |
| FB|FBgn0039474 | 339 | CG6283 [Drosophila melanogaste | 0.515 | 0.634 | 0.378 | 2.2e-34 | |
| FB|FBgn0039476 | 341 | CG6271 [Drosophila melanogaste | 0.529 | 0.648 | 0.375 | 4.6e-34 | |
| FB|FBgn0085476 | 389 | CG34447 [Drosophila melanogast | 0.510 | 0.547 | 0.404 | 7.4e-34 |
| FB|FBgn0031976 CG7367 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 453 (164.5 bits), Expect = 7.3e-43, P = 7.3e-43
Identities = 101/241 (41%), Positives = 138/241 (57%)
Query: 133 YKKGHCKGSVEDMILMAYLELHDYNIICVDWSNLASNRLYPL-ARWTIKYIGQHLADMLT 191
+K S++ I AY+E N+ ++W + A N Y AR+T++ +G+ +A ++
Sbjct: 148 WKSSTMSNSIQS-IRGAYIERGQVNVFAINWKDQADNIYYLTPARYTVQ-VGRAVAKLID 205
Query: 192 TIERTTGYDWCMFHLVGHSLGAHVCGIAGENIAHGKIGRITGLDPALPLFSSNI--TGRL 249
+ D HL+GHSLGAH+ G AG + ++ RITGLDPA P F I L
Sbjct: 206 LLVEEKDADPNRIHLIGHSLGAHIMGYAGSYTKY-RVNRITGLDPARPAFEDCIGPENHL 264
Query: 250 DSTDATFVDIIHTCGGYLGYYQPCGHVDFYPNGGTFIQPGCGW--DIGT-CSHTRSYMFF 306
D TDA FVD+IH+C GYLG+ +P G VDFYPNGG QPGC I T CSH RSY ++
Sbjct: 265 DDTDANFVDVIHSCAGYLGFRKPIGMVDFYPNGGGPPQPGCKELSQIFTGCSHGRSYEYY 324
Query: 307 TESIRTKIGFYARQCNSWSDYKKGHCKGSVEDMILMGEHVNTSARGKYYLMTASSKPYAL 366
ESI + GFY C+ + K +C G ILMG+ V ARG +++ TA+ YAL
Sbjct: 325 AESINSPKGFYGVPCSGLDELKGKNCTGG---KILMGDPVPREARGIFFVKTANKPSYAL 381
Query: 367 G 367
G
Sbjct: 382 G 382
|
|
| FB|FBgn0034166 CG6472 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032612 CG13282 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039471 CG6295 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0031426 CG18641 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039475 CG6277 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P49923 LPL "Lipoprotein lipase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039474 CG6283 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039476 CG6271 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0085476 CG34447 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.1 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 417 | |||
| cd00707 | 275 | cd00707, Pancreat_lipase_like, Pancreatic lipase-l | 8e-94 | |
| pfam00151 | 329 | pfam00151, Lipase, Lipase | 3e-51 | |
| TIGR03230 | 442 | TIGR03230, lipo_lipase, lipoprotein lipase | 2e-38 | |
| cd00707 | 275 | cd00707, Pancreat_lipase_like, Pancreatic lipase-l | 4e-30 | |
| cd00741 | 153 | cd00741, Lipase, Lipase | 9e-20 | |
| pfam00151 | 329 | pfam00151, Lipase, Lipase | 2e-15 | |
| TIGR03230 | 442 | TIGR03230, lipo_lipase, lipoprotein lipase | 1e-11 | |
| cd00741 | 153 | cd00741, Lipase, Lipase | 2e-06 | |
| pfam12697 | 187 | pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam | 0.002 |
| >gnl|CDD|238363 cd00707, Pancreat_lipase_like, Pancreatic lipase-like enzymes | Back alignment and domain information |
|---|
Score = 282 bits (725), Expect = 8e-94
Identities = 105/228 (46%), Positives = 131/228 (57%), Gaps = 11/228 (4%)
Query: 140 GSVEDMILMAYLELHDYNIICVDWSNLASNRLYPLARWTIKYIGQHLADMLTTIERTTGY 199
+ D+ AYL DYN+I VDW A+ YP A + +G LA L + TG
Sbjct: 52 SWISDLRK-AYLSRGDYNVIVVDWGRGANP-NYPQAVNNTRVVGAELAKFLDFLVDNTGL 109
Query: 200 DWCMFHLVGHSLGAHVCGIAGENIAHGKIGRITGLDPALPLFSSNITG-RLDSTDATFVD 258
HL+GHSLGAHV G AG+ + +GK+GRITGLDPA PLFS RLD +DA FVD
Sbjct: 110 SLENVHLIGHSLGAHVAGFAGKRL-NGKLGRITGLDPAGPLFSGADPEDRLDPSDAQFVD 168
Query: 259 IIHTCGGYLGYYQPCGHVDFYPNGGTFIQPGCGWDI-----GTCSHTRSYMFFTESIRTK 313
+IHT GG LG+ QP GH DFYPNGG QPGC DI CSH R+ +F ESI +
Sbjct: 169 VIHTDGGLLGFSQPIGHADFYPNGGRD-QPGCPKDILSSDFVACSHQRAVHYFAESILSP 227
Query: 314 IGFYARQCNSWSDYKKGHCKGSVEDMILMGEHVNTSAR-GKYYLMTAS 360
GF A C+S+ ++ G C + MG H + R GK+YL T +
Sbjct: 228 CGFVAYPCSSYDEFLAGKCFPCGSGCVRMGYHADRFRREGKFYLKTNA 275
|
Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure. A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site. Length = 275 |
| >gnl|CDD|215752 pfam00151, Lipase, Lipase | Back alignment and domain information |
|---|
| >gnl|CDD|132274 TIGR03230, lipo_lipase, lipoprotein lipase | Back alignment and domain information |
|---|
| >gnl|CDD|238363 cd00707, Pancreat_lipase_like, Pancreatic lipase-like enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|238382 cd00741, Lipase, Lipase | Back alignment and domain information |
|---|
| >gnl|CDD|215752 pfam00151, Lipase, Lipase | Back alignment and domain information |
|---|
| >gnl|CDD|132274 TIGR03230, lipo_lipase, lipoprotein lipase | Back alignment and domain information |
|---|
| >gnl|CDD|238382 cd00741, Lipase, Lipase | Back alignment and domain information |
|---|
| >gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 417 | |||
| PF00151 | 331 | Lipase: Lipase; InterPro: IPR013818 Triglyceride l | 100.0 | |
| TIGR03230 | 442 | lipo_lipase lipoprotein lipase. Members of this pr | 100.0 | |
| cd00707 | 275 | Pancreat_lipase_like Pancreatic lipase-like enzyme | 100.0 | |
| PF00151 | 331 | Lipase: Lipase; InterPro: IPR013818 Triglyceride l | 99.97 | |
| TIGR03230 | 442 | lipo_lipase lipoprotein lipase. Members of this pr | 99.97 | |
| cd00707 | 275 | Pancreat_lipase_like Pancreatic lipase-like enzyme | 99.96 | |
| cd00741 | 153 | Lipase Lipase. Lipases are esterases that can hydr | 99.1 | |
| PLN02965 | 255 | Probable pheophorbidase | 99.09 | |
| PLN02824 | 294 | hydrolase, alpha/beta fold family protein | 99.07 | |
| PRK00870 | 302 | haloalkane dehalogenase; Provisional | 99.04 | |
| PF12697 | 228 | Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 | 98.99 | |
| TIGR02240 | 276 | PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer | 98.96 | |
| PRK11126 | 242 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl | 98.96 | |
| PLN02679 | 360 | hydrolase, alpha/beta fold family protein | 98.89 | |
| PF00561 | 230 | Abhydrolase_1: alpha/beta hydrolase fold A web pag | 98.87 | |
| PLN02298 | 330 | hydrolase, alpha/beta fold family protein | 98.87 | |
| PRK10673 | 255 | acyl-CoA esterase; Provisional | 98.86 | |
| PRK03204 | 286 | haloalkane dehalogenase; Provisional | 98.84 | |
| PLN02211 | 273 | methyl indole-3-acetate methyltransferase | 98.84 | |
| PRK03592 | 295 | haloalkane dehalogenase; Provisional | 98.81 | |
| TIGR03343 | 282 | biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die | 98.81 | |
| TIGR03611 | 257 | RutD pyrimidine utilization protein D. This protei | 98.8 | |
| PLN02385 | 349 | hydrolase; alpha/beta fold family protein | 98.77 | |
| TIGR01250 | 288 | pro_imino_pep_2 proline-specific peptidases, Bacil | 98.76 | |
| PRK10349 | 256 | carboxylesterase BioH; Provisional | 98.76 | |
| TIGR03695 | 251 | menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene | 98.74 | |
| PLN02578 | 354 | hydrolase | 98.74 | |
| PHA02857 | 276 | monoglyceride lipase; Provisional | 98.74 | |
| TIGR03056 | 278 | bchO_mg_che_rel putative magnesium chelatase acces | 98.73 | |
| TIGR02427 | 251 | protocat_pcaD 3-oxoadipate enol-lactonase. Members | 98.72 | |
| PRK08775 | 343 | homoserine O-acetyltransferase; Provisional | 98.7 | |
| PRK10749 | 330 | lysophospholipase L2; Provisional | 98.68 | |
| PLN03084 | 383 | alpha/beta hydrolase fold protein; Provisional | 98.67 | |
| PLN03087 | 481 | BODYGUARD 1 domain containing hydrolase; Provision | 98.64 | |
| PLN02894 | 402 | hydrolase, alpha/beta fold family protein | 98.61 | |
| PRK06489 | 360 | hypothetical protein; Provisional | 98.61 | |
| PRK07581 | 339 | hypothetical protein; Validated | 98.56 | |
| TIGR03101 | 266 | hydr2_PEP hydrolase, ortholog 2, exosortase system | 98.52 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 98.5 | |
| TIGR01738 | 245 | bioH putative pimeloyl-BioC--CoA transferase BioH. | 98.48 | |
| TIGR01249 | 306 | pro_imino_pep_1 proline iminopeptidase, Neisseria- | 98.47 | |
| KOG4409|consensus | 365 | 98.46 | ||
| TIGR01392 | 351 | homoserO_Ac_trn homoserine O-acetyltransferase. Th | 98.45 | |
| KOG4178|consensus | 322 | 98.38 | ||
| COG2267 | 298 | PldB Lysophospholipase [Lipid metabolism] | 98.35 | |
| PLN02652 | 395 | hydrolase; alpha/beta fold family protein | 98.34 | |
| PRK00175 | 379 | metX homoserine O-acetyltransferase; Provisional | 98.3 | |
| TIGR01836 | 350 | PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth | 98.25 | |
| KOG2564|consensus | 343 | 98.22 | ||
| KOG1454|consensus | 326 | 98.19 | ||
| TIGR03100 | 274 | hydr1_PEP hydrolase, ortholog 1, exosortase system | 98.18 | |
| PLN02980 | 1655 | 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi | 98.17 | |
| PRK05077 | 414 | frsA fermentation/respiration switch protein; Revi | 98.15 | |
| COG0596 | 282 | MhpC Predicted hydrolases or acyltransferases (alp | 98.08 | |
| PF12695 | 145 | Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 | 98.05 | |
| PRK11071 | 190 | esterase YqiA; Provisional | 98.03 | |
| PLN00021 | 313 | chlorophyllase | 98.03 | |
| PLN02511 | 388 | hydrolase | 98.02 | |
| PRK10566 | 249 | esterase; Provisional | 97.92 | |
| TIGR01607 | 332 | PST-A Plasmodium subtelomeric family (PST-A). Thes | 97.9 | |
| PRK06765 | 389 | homoserine O-acetyltransferase; Provisional | 97.85 | |
| KOG1455|consensus | 313 | 97.83 | ||
| PF05990 | 233 | DUF900: Alpha/beta hydrolase of unknown function ( | 97.81 | |
| PRK10985 | 324 | putative hydrolase; Provisional | 97.81 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 97.79 | |
| PF00326 | 213 | Peptidase_S9: Prolyl oligopeptidase family This fa | 97.76 | |
| TIGR01838 | 532 | PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, | 97.74 | |
| KOG2382|consensus | 315 | 97.7 | ||
| TIGR01840 | 212 | esterase_phb esterase, PHB depolymerase family. Th | 97.61 | |
| PRK13604 | 307 | luxD acyl transferase; Provisional | 97.59 | |
| PF00975 | 229 | Thioesterase: Thioesterase domain; InterPro: IPR00 | 97.56 | |
| PRK10162 | 318 | acetyl esterase; Provisional | 97.54 | |
| TIGR02821 | 275 | fghA_ester_D S-formylglutathione hydrolase. This m | 97.51 | |
| PF06342 | 297 | DUF1057: Alpha/beta hydrolase of unknown function | 97.41 | |
| TIGR00976 | 550 | /NonD putative hydrolase, CocE/NonD family. This m | 97.41 | |
| PLN02442 | 283 | S-formylglutathione hydrolase | 97.4 | |
| PF07819 | 225 | PGAP1: PGAP1-like protein; InterPro: IPR012908 The | 97.33 | |
| PLN02872 | 395 | triacylglycerol lipase | 97.29 | |
| TIGR03502 | 792 | lipase_Pla1_cef extracellular lipase, Pla-1/cef fa | 97.27 | |
| PF10230 | 266 | DUF2305: Uncharacterised conserved protein (DUF230 | 97.23 | |
| PF06057 | 192 | VirJ: Bacterial virulence protein (VirJ); InterPro | 97.13 | |
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 97.12 | |
| PF07859 | 211 | Abhydrolase_3: alpha/beta hydrolase fold A web pag | 97.11 | |
| COG3208 | 244 | GrsT Predicted thioesterase involved in non-riboso | 97.07 | |
| COG1647 | 243 | Esterase/lipase [General function prediction only] | 97.06 | |
| PF01674 | 219 | Lipase_2: Lipase (class 2); InterPro: IPR002918 Li | 96.92 | |
| KOG1552|consensus | 258 | 96.9 | ||
| PRK11460 | 232 | putative hydrolase; Provisional | 96.86 | |
| PF02230 | 216 | Abhydrolase_2: Phospholipase/Carboxylesterase; Int | 96.76 | |
| PLN02733 | 440 | phosphatidylcholine-sterol O-acyltransferase | 96.73 | |
| PF07224 | 307 | Chlorophyllase: Chlorophyllase; InterPro: IPR01082 | 96.69 | |
| COG0429 | 345 | Predicted hydrolase of the alpha/beta-hydrolase fo | 96.59 | |
| PF12740 | 259 | Chlorophyllase2: Chlorophyllase enzyme; InterPro: | 96.38 | |
| smart00824 | 212 | PKS_TE Thioesterase. Peptide synthetases are invol | 96.37 | |
| TIGR01839 | 560 | PHA_synth_II poly(R)-hydroxyalkanoic acid synthase | 96.31 | |
| PF06500 | 411 | DUF1100: Alpha/beta hydrolase of unknown function | 96.21 | |
| PF06028 | 255 | DUF915: Alpha/beta hydrolase of unknown function ( | 96.15 | |
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 96.09 | |
| COG0657 | 312 | Aes Esterase/lipase [Lipid metabolism] | 95.93 | |
| PF01764 | 140 | Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr | 95.8 | |
| PF11187 | 224 | DUF2974: Protein of unknown function (DUF2974); In | 95.75 | |
| PF05677 | 365 | DUF818: Chlamydia CHLPS protein (DUF818); InterPro | 95.68 | |
| COG4782 | 377 | Uncharacterized protein conserved in bacteria [Fun | 95.64 | |
| PF00756 | 251 | Esterase: Putative esterase; InterPro: IPR000801 T | 95.55 | |
| cd00519 | 229 | Lipase_3 Lipase (class 3). Lipases are esterases t | 95.47 | |
| COG0400 | 207 | Predicted esterase [General function prediction on | 95.44 | |
| COG4757 | 281 | Predicted alpha/beta hydrolase [General function p | 95.36 | |
| PF05728 | 187 | UPF0227: Uncharacterised protein family (UPF0227); | 95.24 | |
| PF01738 | 218 | DLH: Dienelactone hydrolase family; InterPro: IPR0 | 95.1 | |
| PTZ00472 | 462 | serine carboxypeptidase (CBP1); Provisional | 94.9 | |
| PF05057 | 217 | DUF676: Putative serine esterase (DUF676); InterPr | 94.8 | |
| KOG4391|consensus | 300 | 94.69 | ||
| PF08840 | 213 | BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term | 94.52 | |
| COG3243 | 445 | PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me | 94.5 | |
| COG3319 | 257 | Thioesterase domains of type I polyketide synthase | 94.46 | |
| PF02450 | 389 | LCAT: Lecithin:cholesterol acyltransferase; InterP | 94.3 | |
| PF10503 | 220 | Esterase_phd: Esterase PHB depolymerase | 94.29 | |
| KOG4627|consensus | 270 | 94.26 | ||
| PF12715 | 390 | Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 | 94.26 | |
| PF06821 | 171 | Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 | 94.23 | |
| PRK10439 | 411 | enterobactin/ferric enterobactin esterase; Provisi | 94.12 | |
| PF06259 | 177 | Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR | 94.0 | |
| KOG3724|consensus | 973 | 93.99 | ||
| TIGR01849 | 406 | PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, | 93.97 | |
| COG2021 | 368 | MET2 Homoserine acetyltransferase [Amino acid tran | 93.92 | |
| PLN02408 | 365 | phospholipase A1 | 93.85 | |
| PF02129 | 272 | Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam | 93.85 | |
| PLN02454 | 414 | triacylglycerol lipase | 93.15 | |
| KOG1515|consensus | 336 | 93.03 | ||
| PF09752 | 348 | DUF2048: Uncharacterized conserved protein (DUF204 | 92.99 | |
| PRK05371 | 767 | x-prolyl-dipeptidyl aminopeptidase; Provisional | 92.3 | |
| PLN02802 | 509 | triacylglycerol lipase | 92.24 | |
| PF05277 | 345 | DUF726: Protein of unknown function (DUF726); Inte | 92.17 | |
| PLN02847 | 633 | triacylglycerol lipase | 92.03 | |
| COG2945 | 210 | Predicted hydrolase of the alpha/beta superfamily | 91.92 | |
| PF01083 | 179 | Cutinase: Cutinase; InterPro: IPR000675 Aerial pla | 91.86 | |
| cd00741 | 153 | Lipase Lipase. Lipases are esterases that can hydr | 91.6 | |
| PLN02324 | 415 | triacylglycerol lipase | 91.59 | |
| COG1075 | 336 | LipA Predicted acetyltransferases and hydrolases w | 91.49 | |
| PLN02571 | 413 | triacylglycerol lipase | 91.41 | |
| KOG2984|consensus | 277 | 91.36 | ||
| PF12146 | 79 | Hydrolase_4: Putative lysophospholipase; InterPro: | 91.32 | |
| PRK04940 | 180 | hypothetical protein; Provisional | 91.24 | |
| PF08538 | 303 | DUF1749: Protein of unknown function (DUF1749); In | 91.19 | |
| COG0412 | 236 | Dienelactone hydrolase and related enzymes [Second | 91.17 | |
| PLN02753 | 531 | triacylglycerol lipase | 90.92 | |
| PLN00413 | 479 | triacylglycerol lipase | 90.82 | |
| PF03403 | 379 | PAF-AH_p_II: Platelet-activating factor acetylhydr | 90.67 | |
| KOG1838|consensus | 409 | 90.38 | ||
| PLN02761 | 527 | lipase class 3 family protein | 90.36 | |
| PLN02162 | 475 | triacylglycerol lipase | 89.81 | |
| PF03583 | 290 | LIP: Secretory lipase ; InterPro: IPR005152 This e | 89.76 | |
| PF05448 | 320 | AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 | 89.5 | |
| PLN02310 | 405 | triacylglycerol lipase | 89.28 | |
| COG4814 | 288 | Uncharacterized protein with an alpha/beta hydrola | 88.45 | |
| COG3946 | 456 | VirJ Type IV secretory pathway, VirJ component [In | 88.39 | |
| PLN02719 | 518 | triacylglycerol lipase | 87.82 | |
| COG2819 | 264 | Predicted hydrolase of the alpha/beta superfamily | 87.74 | |
| PF03096 | 283 | Ndr: Ndr family; InterPro: IPR004142 This family c | 87.66 | |
| COG3545 | 181 | Predicted esterase of the alpha/beta hydrolase fol | 87.36 | |
| PLN03037 | 525 | lipase class 3 family protein; Provisional | 86.8 | |
| PLN02934 | 515 | triacylglycerol lipase | 86.65 | |
| KOG3101|consensus | 283 | 86.62 | ||
| PF08237 | 225 | PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum | 86.06 | |
| KOG1553|consensus | 517 | 85.28 | ||
| COG0627 | 316 | Predicted esterase [General function prediction on | 84.88 | |
| KOG2112|consensus | 206 | 84.58 | ||
| KOG3975|consensus | 301 | 84.0 | ||
| COG1506 | 620 | DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept | 82.95 | |
| KOG2931|consensus | 326 | 82.92 | ||
| PF12048 | 310 | DUF3530: Protein of unknown function (DUF3530); In | 82.7 | |
| KOG2385|consensus | 633 | 82.45 | ||
| PF00450 | 415 | Peptidase_S10: Serine carboxypeptidase; InterPro: | 81.26 | |
| KOG2624|consensus | 403 | 80.93 | ||
| KOG4667|consensus | 269 | 80.69 | ||
| COG3509 | 312 | LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda | 80.04 |
| >PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.2e-65 Score=510.86 Aligned_cols=223 Identities=48% Similarity=0.800 Sum_probs=177.3
Q ss_pred Ccchhhhhhhhhcc--cccEEEEeccCCCccCCCcccccccHHHHHHHHHHHHHHHHHhcCCCcccEEEEEechHHHHHH
Q psy5002 140 GSVEDMILMAYLEL--HDYNIICVDWSNLASNRLYPLARWTIKYIGQHLADMLTTIERTTGYDWCMFHLVGHSLGAHVCG 217 (417)
Q Consensus 140 ~s~~~~ir~a~l~~--~~~nVI~VDw~~~g~s~~Y~~a~~~~~~v~~~la~~l~~L~~~~~~~~~~ihlIGHSLGAhvAg 217 (417)
..|...+++++++. +++|||+|||+..+.. .|..++.+++.||+.|+++|..|.++.+++++++|||||||||||||
T Consensus 87 ~~~~~~~~~all~~~~~d~NVI~VDWs~~a~~-~Y~~a~~n~~~vg~~la~~l~~L~~~~g~~~~~ihlIGhSLGAHvaG 165 (331)
T PF00151_consen 87 ESWIQDMIKALLQKDTGDYNVIVVDWSRGASN-NYPQAVANTRLVGRQLAKFLSFLINNFGVPPENIHLIGHSLGAHVAG 165 (331)
T ss_dssp TTHHHHHHHHHHCC--S-EEEEEEE-HHHHSS--HHHHHHHHHHHHHHHHHHHHHHHHHH---GGGEEEEEETCHHHHHH
T ss_pred hhHHHHHHHHHHhhccCCceEEEEcchhhccc-cccchhhhHHHHHHHHHHHHHHHHhhcCCChhHEEEEeeccchhhhh
Confidence 45677889999988 8999999999998876 79999999999999999999999778899999999999999999999
Q ss_pred HHHhhcCC-CccceEEecCCCCCCCcC-CCCCCCCCCCCceEEEEEeCC-----CcCceeccccceeeecCCCCcCCCCC
Q psy5002 218 IAGENIAH-GKIGRITGLDPALPLFSS-NITGRLDSTDATFVDIIHTCG-----GYLGYYQPCGHVDFYPNGGTFIQPGC 290 (417)
Q Consensus 218 ~~g~~~~~-~~i~rIt~LDpAgP~f~~-~~~~rL~~~dA~fVdvIHT~~-----~~~G~~~~~Gh~DfypNgG~~~QPgC 290 (417)
++|++++. .||+||||||||+|+|+. ++..||+++||+||||||||+ +.+|+.+|+||+||||||| ..||||
T Consensus 166 ~aG~~~~~~~ki~rItgLDPAgP~F~~~~~~~rL~~~DA~fVdvIHT~~~~~~~~~~G~~~~~Gh~DFYpNgG-~~QPGC 244 (331)
T PF00151_consen 166 FAGKYLKGGGKIGRITGLDPAGPLFENNPPSERLDKSDAKFVDVIHTNAGTLPGGGLGTSEPIGHVDFYPNGG-RRQPGC 244 (331)
T ss_dssp HHHHHTTT---SSEEEEES-B-TTTTTS-TTTS--GGGSSEEEEE-SSES-HHH-SSBESS--SSEEEEETTT-TS-TTS
T ss_pred hhhhhccCcceeeEEEecCcccccccCCChhHhhhccCCceEEEEEcCCccccCCccccccccccceeecCCC-ccCCCC
Confidence 99999955 499999999999999998 778999999999999999999 8999999999999999999 779999
Q ss_pred CCCC------CccccchhHHHHHhhccCCCCeEEeeCCCccccccCCcCC-CCccccccccccCC-C-----CceeEEEe
Q psy5002 291 GWDI------GTCSHTRSYMFFTESIRTKIGFYARQCNSWSDYKKGHCKG-SVEDMILMGEHVNT-S-----ARGKYYLM 357 (417)
Q Consensus 291 ~~~~------~~CsH~ra~~~~~eSi~~~~~f~a~~C~s~~~~~~~~C~~-~~~~~~~mG~~~~~-~-----~~G~~yl~ 357 (417)
+... ..|||.||++||+|||.++++|+|++|.||.+|+.++|.. ....++.||++++. + .+|+|||.
T Consensus 245 ~~~~~~~~~~~~CsH~ra~~~f~eSi~~~~~f~a~~C~s~~~~~~g~C~~c~~~~~~~mG~~~~~~~~~~~~~~G~yyl~ 324 (331)
T PF00151_consen 245 GNDSLELTRFISCSHMRAVEYFAESINNPCNFPAVRCSSYDSFLAGKCDGCNNNRCAVMGYHADKFKGKTSPARGIYYLE 324 (331)
T ss_dssp SS-CHTTCSHHHHHHHHHHHHHHHHHHSTTTTB-EE-S-HHHHHTTTS-S--TT---BSSGGGGGSTTTTSSSSEEEEE-
T ss_pred ccccccceecchhhhHHHHHHHHHHhcCCCCceeEeCcCHHHHhhcccccCCCCCCcCCCCCcccCCccccCCCeEEEEe
Confidence 9642 4799999999999999999999999999999999999986 11138999999543 2 68999999
Q ss_pred cCCCCCC
Q psy5002 358 TASSKPY 364 (417)
Q Consensus 358 T~~~~Py 364 (417)
|++++||
T Consensus 325 T~~~~Pf 331 (331)
T PF00151_consen 325 TNAKSPF 331 (331)
T ss_dssp --SSST-
T ss_pred eCCCCcC
Confidence 9999998
|
1.1.3 from EC) are lipolytic enzymes that hydrolyse ester linkages of triglycerides []. Lipases are widely distributed in animals, plants and prokaryotes. At least three tissue-specific isozymes exist in higher vertebrates, pancreatic, hepatic and gastric/lingual. These lipases are closely related to each other and to lipoprotein lipase (3.1.1.34 from EC), which hydrolyses triglycerides of chylomicrons and very low density lipoproteins (VLDL) []. The most conserved region in all these proteins is centred around a serine residue which has been shown [] to participate, with an histidine and an aspartic acid residue, in a charge relay system. Such a region is also present in lipases of prokaryotic origin and in lecithin-cholesterol acyltransferase (2.3.1.43 from EC) (LCAT) [], which catalyzes fatty acid transfer between phosphatidylcholine and cholesterol.; PDB: 1LPB_B 1LPA_B 1N8S_A 1GPL_A 1W52_X 2PVS_B 2OXE_B 1BU8_A 2PPL_A 1ETH_A .... |
| >TIGR03230 lipo_lipase lipoprotein lipase | Back alignment and domain information |
|---|
| >cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes | Back alignment and domain information |
|---|
| >PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 | Back alignment and domain information |
|---|
| >TIGR03230 lipo_lipase lipoprotein lipase | Back alignment and domain information |
|---|
| >cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes | Back alignment and domain information |
|---|
| >cd00741 Lipase Lipase | Back alignment and domain information |
|---|
| >PLN02965 Probable pheophorbidase | Back alignment and domain information |
|---|
| >PLN02824 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK00870 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A | Back alignment and domain information |
|---|
| >TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase | Back alignment and domain information |
|---|
| >PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02679 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >PLN02298 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK10673 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >PRK03204 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02211 methyl indole-3-acetate methyltransferase | Back alignment and domain information |
|---|
| >PRK03592 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase | Back alignment and domain information |
|---|
| >TIGR03611 RutD pyrimidine utilization protein D | Back alignment and domain information |
|---|
| >PLN02385 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily | Back alignment and domain information |
|---|
| >PRK10349 carboxylesterase BioH; Provisional | Back alignment and domain information |
|---|
| >TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PLN02578 hydrolase | Back alignment and domain information |
|---|
| >PHA02857 monoglyceride lipase; Provisional | Back alignment and domain information |
|---|
| >TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein | Back alignment and domain information |
|---|
| >TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase | Back alignment and domain information |
|---|
| >PRK08775 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10749 lysophospholipase L2; Provisional | Back alignment and domain information |
|---|
| >PLN03084 alpha/beta hydrolase fold protein; Provisional | Back alignment and domain information |
|---|
| >PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02894 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK06489 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07581 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH | Back alignment and domain information |
|---|
| >TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily | Back alignment and domain information |
|---|
| >KOG4409|consensus | Back alignment and domain information |
|---|
| >TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase | Back alignment and domain information |
|---|
| >KOG4178|consensus | Back alignment and domain information |
|---|
| >COG2267 PldB Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02652 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK00175 metX homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit | Back alignment and domain information |
|---|
| >KOG2564|consensus | Back alignment and domain information |
|---|
| >KOG1454|consensus | Back alignment and domain information |
|---|
| >TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding | Back alignment and domain information |
|---|
| >PRK05077 frsA fermentation/respiration switch protein; Reviewed | Back alignment and domain information |
|---|
| >COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A | Back alignment and domain information |
|---|
| >PRK11071 esterase YqiA; Provisional | Back alignment and domain information |
|---|
| >PLN00021 chlorophyllase | Back alignment and domain information |
|---|
| >PLN02511 hydrolase | Back alignment and domain information |
|---|
| >PRK10566 esterase; Provisional | Back alignment and domain information |
|---|
| >TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) | Back alignment and domain information |
|---|
| >PRK06765 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1455|consensus | Back alignment and domain information |
|---|
| >PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >PRK10985 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification | Back alignment and domain information |
|---|
| >TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I | Back alignment and domain information |
|---|
| >KOG2382|consensus | Back alignment and domain information |
|---|
| >TIGR01840 esterase_phb esterase, PHB depolymerase family | Back alignment and domain information |
|---|
| >PRK13604 luxD acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] | Back alignment and domain information |
|---|
| >PRK10162 acetyl esterase; Provisional | Back alignment and domain information |
|---|
| >TIGR02821 fghA_ester_D S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold | Back alignment and domain information |
|---|
| >TIGR00976 /NonD putative hydrolase, CocE/NonD family | Back alignment and domain information |
|---|
| >PLN02442 S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) | Back alignment and domain information |
|---|
| >PLN02872 triacylglycerol lipase | Back alignment and domain information |
|---|
| >TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family | Back alignment and domain information |
|---|
| >PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG1647 Esterase/lipase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] | Back alignment and domain information |
|---|
| >KOG1552|consensus | Back alignment and domain information |
|---|
| >PRK11460 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases | Back alignment and domain information |
|---|
| >PLN02733 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 | Back alignment and domain information |
|---|
| >COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 | Back alignment and domain information |
|---|
| >smart00824 PKS_TE Thioesterase | Back alignment and domain information |
|---|
| >TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II | Back alignment and domain information |
|---|
| >PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] | Back alignment and domain information |
|---|
| >PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >COG0657 Aes Esterase/lipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] | Back alignment and domain information |
|---|
| >PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins | Back alignment and domain information |
|---|
| >COG4782 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae | Back alignment and domain information |
|---|
| >cd00519 Lipase_3 Lipase (class 3) | Back alignment and domain information |
|---|
| >COG0400 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4757 Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO | Back alignment and domain information |
|---|
| >PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway | Back alignment and domain information |
|---|
| >PTZ00472 serine carboxypeptidase (CBP1); Provisional | Back alignment and domain information |
|---|
| >PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases | Back alignment and domain information |
|---|
| >KOG4391|consensus | Back alignment and domain information |
|---|
| >PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH | Back alignment and domain information |
|---|
| >COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 | Back alignment and domain information |
|---|
| >PF10503 Esterase_phd: Esterase PHB depolymerase | Back alignment and domain information |
|---|
| >KOG4627|consensus | Back alignment and domain information |
|---|
| >PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A | Back alignment and domain information |
|---|
| >PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic | Back alignment and domain information |
|---|
| >PRK10439 enterobactin/ferric enterobactin esterase; Provisional | Back alignment and domain information |
|---|
| >PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria | Back alignment and domain information |
|---|
| >KOG3724|consensus | Back alignment and domain information |
|---|
| >TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular | Back alignment and domain information |
|---|
| >COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02408 phospholipase A1 | Back alignment and domain information |
|---|
| >PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] | Back alignment and domain information |
|---|
| >PLN02454 triacylglycerol lipase | Back alignment and domain information |
|---|
| >KOG1515|consensus | Back alignment and domain information |
|---|
| >PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >PLN02802 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins | Back alignment and domain information |
|---|
| >PLN02847 triacylglycerol lipase | Back alignment and domain information |
|---|
| >COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] | Back alignment and domain information |
|---|
| >cd00741 Lipase Lipase | Back alignment and domain information |
|---|
| >PLN02324 triacylglycerol lipase | Back alignment and domain information |
|---|
| >COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02571 triacylglycerol lipase | Back alignment and domain information |
|---|
| >KOG2984|consensus | Back alignment and domain information |
|---|
| >PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >PRK04940 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function | Back alignment and domain information |
|---|
| >COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02753 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN00413 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A | Back alignment and domain information |
|---|
| >KOG1838|consensus | Back alignment and domain information |
|---|
| >PLN02761 lipase class 3 family protein | Back alignment and domain information |
|---|
| >PLN02162 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases | Back alignment and domain information |
|---|
| >PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins | Back alignment and domain information |
|---|
| >PLN02310 triacylglycerol lipase | Back alignment and domain information |
|---|
| >COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN02719 triacylglycerol lipase | Back alignment and domain information |
|---|
| >COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 | Back alignment and domain information |
|---|
| >COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03037 lipase class 3 family protein; Provisional | Back alignment and domain information |
|---|
| >PLN02934 triacylglycerol lipase | Back alignment and domain information |
|---|
| >KOG3101|consensus | Back alignment and domain information |
|---|
| >PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) | Back alignment and domain information |
|---|
| >KOG1553|consensus | Back alignment and domain information |
|---|
| >COG0627 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2112|consensus | Back alignment and domain information |
|---|
| >KOG3975|consensus | Back alignment and domain information |
|---|
| >COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2931|consensus | Back alignment and domain information |
|---|
| >PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG2385|consensus | Back alignment and domain information |
|---|
| >PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG2624|consensus | Back alignment and domain information |
|---|
| >KOG4667|consensus | Back alignment and domain information |
|---|
| >COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 417 | ||||
| 1hpl_A | 449 | Horse Pancreatic Lipase. The Crystal Structure At 2 | 1e-29 | ||
| 1bu8_A | 452 | Rat Pancreatic Lipase Related Protein 2 Length = 45 | 3e-29 | ||
| 1lpa_B | 449 | Interfacial Activation Of The Lipase-Procolipase Co | 1e-28 | ||
| 2ppl_A | 485 | Human Pancreatic Lipase-Related Protein 1 Length = | 2e-28 | ||
| 1rp1_A | 450 | Dog Pancreatic Lipase Related Protein 1 Length = 45 | 2e-28 | ||
| 1gpl_A | 432 | Rp2 Lipase Length = 432 | 5e-28 | ||
| 1w52_X | 452 | Crystal Structure Of A Proteolyzed Form Of Pancreat | 3e-27 | ||
| 1eth_A | 448 | Triacylglycerol LipaseCOLIPASE COMPLEX Length = 448 | 5e-27 | ||
| 2pvs_A | 452 | Structure Of Human Pancreatic Lipase Related Protei | 1e-24 | ||
| 2oxe_A | 466 | Structure Of The Human Pancreatic Lipase-Related Pr | 2e-24 |
| >pdb|1HPL|A Chain A, Horse Pancreatic Lipase. The Crystal Structure At 2.3 Angstroms Resolution Length = 449 | Back alignment and structure |
|
| >pdb|1BU8|A Chain A, Rat Pancreatic Lipase Related Protein 2 Length = 452 | Back alignment and structure |
| >pdb|1LPA|B Chain B, Interfacial Activation Of The Lipase-Procolipase Complex By Mixed Micelles Revealed By X-Ray Crystallography Length = 449 | Back alignment and structure |
| >pdb|2PPL|A Chain A, Human Pancreatic Lipase-Related Protein 1 Length = 485 | Back alignment and structure |
| >pdb|1RP1|A Chain A, Dog Pancreatic Lipase Related Protein 1 Length = 450 | Back alignment and structure |
| >pdb|1GPL|A Chain A, Rp2 Lipase Length = 432 | Back alignment and structure |
| >pdb|1W52|X Chain X, Crystal Structure Of A Proteolyzed Form Of Pancreatic Lipase Related Protein 2 From Horse Length = 452 | Back alignment and structure |
| >pdb|1ETH|A Chain A, Triacylglycerol LipaseCOLIPASE COMPLEX Length = 448 | Back alignment and structure |
| >pdb|2PVS|A Chain A, Structure Of Human Pancreatic Lipase Related Protein 2 Mutant N336q Length = 452 | Back alignment and structure |
| >pdb|2OXE|A Chain A, Structure Of The Human Pancreatic Lipase-Related Protein 2 Length = 466 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Length = 449 | Back alignment and structure |
|---|
Score = 247 bits (631), Expect = 8e-78
Identities = 82/266 (30%), Positives = 118/266 (44%), Gaps = 34/266 (12%)
Query: 135 KGHCKGSVEDMILMAYLELHDYNIICVDWSNLASNRLYPLARWTIKYIGQHLADMLTTIE 194
+ S + ++ N ICVDW + + Y A ++ +G +A ++ ++
Sbjct: 79 IDKGEESWLSTMCQNMFKVESVNCICVDWKSGSRT-AYSQASQNVRIVGAEVAYLVGVLQ 137
Query: 195 RTTGYDWCMFHLVGHSLGAHVCGIAGENIAHGKIGRITGLDPALPLFSSNITG-RLDSTD 253
+ Y H++GHSLG+H G AG +G +GRITGLDPA P F RLD +D
Sbjct: 138 SSFDYSPSNVHIIGHSLGSHAAGEAGRRT-NGAVGRITGLDPAEPCFQGTPELVRLDPSD 196
Query: 254 ATFVDIIHTCGGYL------GYYQPCGHVDFYPNGGTFIQPGCG---------------- 291
A FVD+IHT G Q GH+DF+PNGG PGC
Sbjct: 197 AQFVDVIHTDIAPFIPNLGFGMSQTAGHLDFFPNGGKE-MPGCQKNVLSQIVDIDGIWQG 255
Query: 292 -WDIGTCSHTRSYMFFTESIRTKIGFYARQCNSWSDYKKGHCKGSVEDMI-LMGEHVN-- 347
D C+H RSY ++T+SI GF C S+SD+ C + MG + +
Sbjct: 256 TRDFAACNHLRSYKYYTDSILNPDGFAGFSCASYSDFTANKCFPCSSEGCPQMGHYADRF 315
Query: 348 ----TSARGKYYLMTASSKPYALGRY 369
+YL T + +A RY
Sbjct: 316 PGRTKGVGQLFYLNTGDASNFARWRY 341
|
| >1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Length = 449 | Back alignment and structure |
|---|
| >1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Length = 452 | Back alignment and structure |
|---|
| >1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Length = 452 | Back alignment and structure |
|---|
| >1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Length = 432 | Back alignment and structure |
|---|
| >1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Length = 432 | Back alignment and structure |
|---|
| >1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Length = 452 | Back alignment and structure |
|---|
| >1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Length = 452 | Back alignment and structure |
|---|
| >1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Length = 450 | Back alignment and structure |
|---|
| >1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Length = 450 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 417 | |||
| 1rp1_A | 450 | Pancreatic lipase related protein 1; hydrolase, li | 100.0 | |
| 1hpl_A | 449 | Lipase; hydrolase(carboxylic esterase); 2.30A {Equ | 100.0 | |
| 1w52_X | 452 | Pancreatic lipase related protein 2; detergent, cl | 100.0 | |
| 1bu8_A | 452 | Protein (pancreatic lipase related protein 2); hyd | 100.0 | |
| 1gpl_A | 432 | RP2 lipase; serine esterase, hydrolase, lipid degr | 100.0 | |
| 1hpl_A | 449 | Lipase; hydrolase(carboxylic esterase); 2.30A {Equ | 99.91 | |
| 1rp1_A | 450 | Pancreatic lipase related protein 1; hydrolase, li | 99.91 | |
| 1bu8_A | 452 | Protein (pancreatic lipase related protein 2); hyd | 99.87 | |
| 1w52_X | 452 | Pancreatic lipase related protein 2; detergent, cl | 99.86 | |
| 1gpl_A | 432 | RP2 lipase; serine esterase, hydrolase, lipid degr | 99.78 | |
| 2wfl_A | 264 | Polyneuridine-aldehyde esterase; alkaloid metaboli | 99.28 | |
| 1zoi_A | 276 | Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo | 99.23 | |
| 3c6x_A | 257 | Hydroxynitrilase; atomic resolution, hydroxynitril | 99.23 | |
| 2xt0_A | 297 | Haloalkane dehalogenase; hydrolase, alpha-beta hyd | 99.21 | |
| 1brt_A | 277 | Bromoperoxidase A2; haloperoxidase, oxidoreductase | 99.21 | |
| 1xkl_A | 273 | SABP2, salicylic acid-binding protein 2; alpha-bet | 99.21 | |
| 1ehy_A | 294 | Protein (soluble epoxide hydrolase); alpha/beta hy | 99.2 | |
| 1a88_A | 275 | Chloroperoxidase L; haloperoxidase, oxidoreductase | 99.19 | |
| 3afi_E | 316 | Haloalkane dehalogenase; A/B-hydrolase, hydrolase; | 99.18 | |
| 2xua_A | 266 | PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate | 99.18 | |
| 2wj6_A | 276 | 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid | 99.18 | |
| 1hkh_A | 279 | Gamma lactamase; hydrolase, alpha/beta hydrolase, | 99.18 | |
| 1a8q_A | 274 | Bromoperoxidase A1; haloperoxidase, oxidoreductase | 99.17 | |
| 1a8s_A | 273 | Chloroperoxidase F; haloperoxidase, oxidoreductase | 99.16 | |
| 2wue_A | 291 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas | 99.16 | |
| 3ia2_A | 271 | Arylesterase; alpha-beta hydrolase fold, transitio | 99.16 | |
| 1b6g_A | 310 | Haloalkane dehalogenase; hydrolase, alpha/beta-hyd | 99.16 | |
| 1q0r_A | 298 | RDMC, aclacinomycin methylesterase; anthracycline, | 99.15 | |
| 3om8_A | 266 | Probable hydrolase; structural genomics, PSI-2, pr | 99.15 | |
| 3bf7_A | 255 | Esterase YBFF; thioesterase, helical CAP, hydrolas | 99.15 | |
| 2puj_A | 286 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; | 99.15 | |
| 1iup_A | 282 | META-cleavage product hydrolase; aromatic compound | 99.14 | |
| 3bwx_A | 285 | Alpha/beta hydrolase; YP_496220.1, joint center fo | 99.14 | |
| 3dqz_A | 258 | Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl | 99.14 | |
| 2xmz_A | 269 | Hydrolase, alpha/beta hydrolase fold family; menaq | 99.13 | |
| 3v48_A | 268 | Aminohydrolase, putative aminoacrylate hydrolase R | 99.13 | |
| 3fob_A | 281 | Bromoperoxidase; structural genomics, IDP00046, ba | 99.12 | |
| 2yys_A | 286 | Proline iminopeptidase-related protein; TTHA1809, | 99.12 | |
| 2cjp_A | 328 | Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu | 99.11 | |
| 1wom_A | 271 | RSBQ, sigma factor SIGB regulation protein RSBQ; a | 99.1 | |
| 3sty_A | 267 | Methylketone synthase 1; alpha/beta hydrolase, dec | 99.1 | |
| 1c4x_A | 285 | BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di | 99.07 | |
| 3kda_A | 301 | CFTR inhibitory factor (CIF); alpha/beta hydrolase | 99.06 | |
| 3ibt_A | 264 | 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, | 99.05 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 99.05 | |
| 2psd_A | 318 | Renilla-luciferin 2-monooxygenase; alpha/beta-hydr | 99.05 | |
| 3u1t_A | 309 | DMMA haloalkane dehalogenase; alpha/beta-hydrolase | 99.04 | |
| 3r40_A | 306 | Fluoroacetate dehalogenase; FACD, defluorinase, al | 99.03 | |
| 1u2e_A | 289 | 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase | 99.03 | |
| 4dnp_A | 269 | DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu | 99.02 | |
| 1r3d_A | 264 | Conserved hypothetical protein VC1974; structural | 99.02 | |
| 3oos_A | 278 | Alpha/beta hydrolase family protein; APC67239.0, p | 99.01 | |
| 4fbl_A | 281 | LIPS lipolytic enzyme; thermostable, structural ge | 99.01 | |
| 1wm1_A | 317 | Proline iminopeptidase; complex with inhibitor, hy | 99.01 | |
| 1azw_A | 313 | Proline iminopeptidase; aminopeptidase, serine pro | 99.01 | |
| 1j1i_A | 296 | META cleavage compound hydrolase; carbazole degrad | 99.0 | |
| 1mtz_A | 293 | Proline iminopeptidase; alpha-beta hydrolase, CAP | 99.0 | |
| 2ocg_A | 254 | Valacyclovir hydrolase; alpha beta hydrolase fold; | 99.0 | |
| 3nwo_A | 330 | PIP, proline iminopeptidase; structural genomics, | 98.99 | |
| 3fsg_A | 272 | Alpha/beta superfamily hydrolase; PF00561, MCSG, P | 98.97 | |
| 3qit_A | 286 | CURM TE, polyketide synthase; thioesterase, alpha/ | 98.97 | |
| 3qvm_A | 282 | OLEI00960; structural genomics, PSI-biology, midwe | 98.97 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 98.96 | |
| 3r0v_A | 262 | Alpha/beta hydrolase fold protein; structural geno | 98.96 | |
| 3g9x_A | 299 | Haloalkane dehalogenase; alpha/beta hydrolase, hel | 98.95 | |
| 3c5v_A | 316 | PME-1, protein phosphatase methylesterase 1; demet | 98.95 | |
| 2wtm_A | 251 | EST1E; hydrolase; 1.60A {Clostridium proteoclastic | 98.94 | |
| 3p2m_A | 330 | Possible hydrolase; alpha/beta hydrolase superfami | 98.93 | |
| 2qvb_A | 297 | Haloalkane dehalogenase 3; RV2579, alpha-beta hydr | 98.93 | |
| 3hss_A | 293 | Putative bromoperoxidase; alpha beta hydrolase, ox | 98.93 | |
| 3pe6_A | 303 | Monoglyceride lipase; alpha-beta hydrolase fold, 2 | 98.93 | |
| 3qyj_A | 291 | ALR0039 protein; alpha/beta fold, hydrolase; 1.78A | 98.91 | |
| 1mj5_A | 302 | 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; | 98.89 | |
| 1m33_A | 258 | BIOH protein; alpha-betta-alpha sandwich, structur | 98.89 | |
| 2r11_A | 306 | Carboxylesterase NP; 2632844, putative hydrolase, | 98.88 | |
| 3hju_A | 342 | Monoglyceride lipase; alpha/beta hydrolase, hydrol | 98.84 | |
| 3llc_A | 270 | Putative hydrolase; structural genomics, joint cen | 98.84 | |
| 3dkr_A | 251 | Esterase D; alpha beta hydrolase, mechanism, catal | 98.83 | |
| 3kxp_A | 314 | Alpha-(N-acetylaminomethylene)succinic acid hydrol | 98.82 | |
| 1tqh_A | 247 | Carboxylesterase precursor; tetrahedral intermedia | 98.81 | |
| 3fla_A | 267 | RIFR; alpha-beta hydrolase thioesterase, hydrolase | 98.8 | |
| 2qmq_A | 286 | Protein NDRG2, protein NDR2; alpha/beta-hydrolases | 98.8 | |
| 4g9e_A | 279 | AHL-lactonase, alpha/beta hydrolase fold protein; | 98.79 | |
| 3pfb_A | 270 | Cinnamoyl esterase; alpha/beta hydrolase fold, hyd | 98.77 | |
| 3i1i_A | 377 | Homoserine O-acetyltransferase; structural genomic | 98.75 | |
| 2pl5_A | 366 | Homoserine O-acetyltransferase; alpha/beta hydrola | 98.75 | |
| 3b12_A | 304 | Fluoroacetate dehalogenase; dehalogease, hydrolase | 98.22 | |
| 3bdi_A | 207 | Uncharacterized protein TA0194; NP_393672.1, predi | 98.74 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 98.73 | |
| 3vdx_A | 456 | Designed 16NM tetrahedral protein CAGE containing | 98.73 | |
| 1k8q_A | 377 | Triacylglycerol lipase, gastric; APHA beta hydrola | 98.72 | |
| 4i19_A | 388 | Epoxide hydrolase; structural genomics, PSI-biolog | 98.72 | |
| 1tht_A | 305 | Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. | 98.72 | |
| 3e0x_A | 245 | Lipase-esterase related protein; APC60309, clostri | 98.71 | |
| 2e3j_A | 356 | Epoxide hydrolase EPHB; epoxide hydrolase B, struc | 98.71 | |
| 2vat_A | 444 | Acetyl-COA--deacetylcephalosporin C acetyltransfer | 98.7 | |
| 3rm3_A | 270 | MGLP, thermostable monoacylglycerol lipase; alpha/ | 98.7 | |
| 1pja_A | 302 | Palmitoyl-protein thioesterase 2 precursor; hydrol | 98.69 | |
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 98.69 | |
| 2b61_A | 377 | Homoserine O-acetyltransferase; acyl-enzyme, aspar | 98.68 | |
| 1fj2_A | 232 | Protein (acyl protein thioesterase 1); alpha/beta | 98.66 | |
| 2y6u_A | 398 | Peroxisomal membrane protein LPX1; hydrolase, puta | 98.64 | |
| 3qmv_A | 280 | Thioesterase, REDJ; alpha/beta hydrolase fold, hyd | 98.59 | |
| 3og9_A | 209 | Protein YAHD A copper inducible hydrolase; alpha/b | 98.58 | |
| 2o2g_A | 223 | Dienelactone hydrolase; YP_324580.1, structural ge | 98.58 | |
| 1ufo_A | 238 | Hypothetical protein TT1662; alpha-beta fold, hydr | 98.57 | |
| 2h1i_A | 226 | Carboxylesterase; structural genomics, PSI-2, prot | 98.57 | |
| 1imj_A | 210 | CIB, CCG1-interacting factor B; alpha/beta hydrola | 98.56 | |
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 98.55 | |
| 1auo_A | 218 | Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl | 98.54 | |
| 2rau_A | 354 | Putative esterase; NP_343859.1, putative lipase, s | 98.52 | |
| 2i3d_A | 249 | AGR_C_3351P, hypothetical protein ATU1826; structu | 98.52 | |
| 3ksr_A | 290 | Putative serine hydrolase; catalytic triad, struct | 98.5 | |
| 3cn9_A | 226 | Carboxylesterase; alpha/beta hydrolase fold super- | 98.49 | |
| 2dst_A | 131 | Hypothetical protein TTHA1544; conserved hypotheti | 98.49 | |
| 2fuk_A | 220 | XC6422 protein; A/B hydrolase, structural genomics | 98.46 | |
| 1ys1_X | 320 | Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h | 98.45 | |
| 3g02_A | 408 | Epoxide hydrolase; alpha/beta hydrolase fold, enan | 98.44 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 98.44 | |
| 2q0x_A | 335 | Protein DUF1749, uncharacterized protein; alpha/be | 98.42 | |
| 1ex9_A | 285 | Lactonizing lipase; alpha-beta hydrolase fold, pho | 98.41 | |
| 2qjw_A | 176 | Uncharacterized protein XCC1541; putative hydrolas | 98.41 | |
| 3trd_A | 208 | Alpha/beta hydrolase; cellular processes; 1.50A {C | 98.41 | |
| 3ils_A | 265 | PKS, aflatoxin biosynthesis polyketide synthase; A | 98.39 | |
| 2hdw_A | 367 | Hypothetical protein PA2218; alpha/beta hydrolase | 98.38 | |
| 2r8b_A | 251 | AGR_C_4453P, uncharacterized protein ATU2452; APC6 | 98.38 | |
| 2qs9_A | 194 | Retinoblastoma-binding protein 9; B5T overexpresse | 98.34 | |
| 3bxp_A | 277 | Putative lipase/esterase; putative carboxylesteras | 98.34 | |
| 3lcr_A | 319 | Tautomycetin biosynthetic PKS; alpha-beta hydrolas | 98.33 | |
| 3fle_A | 249 | SE_1780 protein; structural genomics, APC61035.1, | 98.33 | |
| 2x5x_A | 342 | PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE | 98.33 | |
| 2pbl_A | 262 | Putative esterase/lipase/thioesterase; alpha/beta- | 98.31 | |
| 3hxk_A | 276 | Sugar hydrolase; alpha-beta protein., structural g | 98.29 | |
| 3b5e_A | 223 | MLL8374 protein; NP_108484.1, carboxylesterase, st | 98.29 | |
| 3h04_A | 275 | Uncharacterized protein; protein with unknown func | 98.29 | |
| 1jfr_A | 262 | Lipase; serine hydrolase; 1.90A {Streptomyces exfo | 98.28 | |
| 1jji_A | 311 | Carboxylesterase; alpha-beta hydrolase fold, hydro | 98.28 | |
| 1kez_A | 300 | Erythronolide synthase; polyketide synthase, modul | 98.24 | |
| 3bjr_A | 283 | Putative carboxylesterase; structural genomics, jo | 98.24 | |
| 3lp5_A | 250 | Putative cell surface hydrolase; structural genom | 98.23 | |
| 1uxo_A | 192 | YDEN protein; hydrolase, A/B hydrolase, esterase, | 98.23 | |
| 3fcy_A | 346 | Xylan esterase 1; alpha/beta hydrolase, carbohydra | 98.22 | |
| 1qlw_A | 328 | Esterase; anisotropic refinement, atomic resolutio | 98.22 | |
| 2c7b_A | 311 | Carboxylesterase, ESTE1; carboxyesterase, thermoph | 98.22 | |
| 1ei9_A | 279 | Palmitoyl protein thioesterase 1; alpha/beta hydro | 98.2 | |
| 2wir_A | 313 | Pesta, alpha/beta hydrolase fold-3 domain protein; | 98.19 | |
| 1lzl_A | 323 | Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod | 98.18 | |
| 3u0v_A | 239 | Lysophospholipase-like protein 1; alpha, beta hydr | 98.17 | |
| 1zi8_A | 236 | Carboxymethylenebutenolidase; alpha and beta prote | 98.17 | |
| 3tej_A | 329 | Enterobactin synthase component F; nonribosomal pe | 98.16 | |
| 1vkh_A | 273 | Putative serine hydrolase; structural genomics, jo | 98.14 | |
| 1l7a_A | 318 | Cephalosporin C deacetylase; structural genomics, | 98.13 | |
| 3k2i_A | 422 | Acyl-coenzyme A thioesterase 4; alpha/beta hydrola | 98.13 | |
| 3vis_A | 306 | Esterase; alpha/beta-hydrolase fold, polyethylene | 98.11 | |
| 2zyr_A | 484 | Lipase, putative; fatty acid, hydrolase; HET: 1PE; | 98.1 | |
| 3hlk_A | 446 | Acyl-coenzyme A thioesterase 2, mitochondrial; alp | 98.1 | |
| 2hm7_A | 310 | Carboxylesterase; alpha/beta hydrolase fold, hydro | 98.1 | |
| 3mve_A | 415 | FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ | 98.09 | |
| 3e4d_A | 278 | Esterase D; S-formylglutathione hydrolase, hydrola | 98.07 | |
| 3f67_A | 241 | Putative dienelactone hydrolase; alpha-beta-alpha | 98.05 | |
| 3d7r_A | 326 | Esterase; alpha/beta fold, hydrolase; 2.01A {Staph | 98.03 | |
| 3n2z_B | 446 | Lysosomal Pro-X carboxypeptidase; alpha/beta hydro | 98.03 | |
| 2uz0_A | 263 | Esterase, tributyrin esterase; alpha/beta hydrolas | 98.02 | |
| 4e15_A | 303 | Kynurenine formamidase; alpha/beta hydrolase fold, | 98.01 | |
| 2jbw_A | 386 | Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine | 98.01 | |
| 2o7r_A | 338 | CXE carboxylesterase; alpha/beta hydrolase; 1.40A | 98.01 | |
| 1vlq_A | 337 | Acetyl xylan esterase; TM0077, structural genomics | 97.99 | |
| 3ds8_A | 254 | LIN2722 protein; unkonwn function, structural geno | 97.99 | |
| 3fnb_A | 405 | Acylaminoacyl peptidase SMU_737; alpha-beta-alpha | 97.99 | |
| 2hfk_A | 319 | Pikromycin, type I polyketide synthase pikaiv; alp | 97.98 | |
| 2zsh_A | 351 | Probable gibberellin receptor GID1L1; plant hormon | 97.97 | |
| 3ain_A | 323 | 303AA long hypothetical esterase; carboxylesterase | 97.95 | |
| 2k2q_B | 242 | Surfactin synthetase thioesterase subunit; A/B-hyd | 97.95 | |
| 4fle_A | 202 | Esterase; structural genomics, PSI-biology, northe | 97.95 | |
| 3d0k_A | 304 | Putative poly(3-hydroxybutyrate) depolymerase LPQ; | 97.93 | |
| 3bdv_A | 191 | Uncharacterized protein DUF1234; DUF1234 family pr | 97.93 | |
| 4h0c_A | 210 | Phospholipase/carboxylesterase; PSI-biology, midwe | 97.93 | |
| 3h2g_A | 397 | Esterase; xanthomonas oryzae PV. oryzae, cell WALL | 97.86 | |
| 2dsn_A | 387 | Thermostable lipase; T1 lipase, hydrolase; 1.50A { | 97.86 | |
| 3tjm_A | 283 | Fatty acid synthase; thioesterase domain, fatty ac | 97.86 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 97.85 | |
| 3k6k_A | 322 | Esterase/lipase; alpha/beta hydrolase fold; 2.20A | 97.85 | |
| 1dqz_A | 280 | 85C, protein (antigen 85-C); fibronectin, structur | 97.83 | |
| 3fcx_A | 282 | FGH, esterase D, S-formylglutathione hydrolase; re | 97.82 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 97.8 | |
| 1jkm_A | 361 | Brefeldin A esterase; serine hydrolase, degradatio | 97.8 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 97.78 | |
| 2cb9_A | 244 | Fengycin synthetase; thioesterase, non-ribosomal p | 97.77 | |
| 3d59_A | 383 | Platelet-activating factor acetylhydrolase; secret | 97.76 | |
| 3fak_A | 322 | Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc | 97.75 | |
| 3qh4_A | 317 | Esterase LIPW; structural genomics, ssgcid, seattl | 97.73 | |
| 2hih_A | 431 | Lipase 46 kDa form; A1 phospholipase, phospholipid | 97.72 | |
| 1jmk_C | 230 | SRFTE, surfactin synthetase; thioesterase, non-rib | 97.72 | |
| 1jjf_A | 268 | Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x | 97.7 | |
| 3i6y_A | 280 | Esterase APC40077; lipase, structural genomics, PS | 97.7 | |
| 4b6g_A | 283 | Putative esterase; hydrolase, formaldehyde detoxif | 97.69 | |
| 1r88_A | 280 | MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP | 97.69 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 97.68 | |
| 3g8y_A | 391 | SUSD/RAGB-associated esterase-like protein; struct | 97.66 | |
| 2fx5_A | 258 | Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse | 97.66 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 97.66 | |
| 2qru_A | 274 | Uncharacterized protein; alpha/beta-hydrolase, str | 97.65 | |
| 3ga7_A | 326 | Acetyl esterase; phosphoserine, IDP00896, hydrolas | 97.63 | |
| 4ezi_A | 377 | Uncharacterized protein; alpha-beta hydrolases fol | 97.51 | |
| 3nuz_A | 398 | Putative acetyl xylan esterase; structural genomic | 97.49 | |
| 3doh_A | 380 | Esterase; alpha-beta hydrolase, beta sheet; 2.60A | 97.48 | |
| 1sfr_A | 304 | Antigen 85-A; alpha/beta hydrolase, structural gen | 97.42 | |
| 1lns_A | 763 | X-prolyl dipeptidyl aminopetidase; alpha beta hydr | 97.41 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 97.4 | |
| 3i2k_A | 587 | Cocaine esterase; alpha/beta hydrolase, hydrolase; | 97.4 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 97.4 | |
| 3ebl_A | 365 | Gibberellin receptor GID1; alpha/beta hydrolase, l | 97.4 | |
| 3ls2_A | 280 | S-formylglutathione hydrolase; psychrophilic organ | 97.38 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 97.36 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 97.32 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 97.29 | |
| 3iii_A | 560 | COCE/NOND family hydrolase; structural genomics, c | 97.25 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 97.18 | |
| 1mpx_A | 615 | Alpha-amino acid ester hydrolase; alpha/beta hydro | 97.14 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 97.02 | |
| 4fhz_A | 285 | Phospholipase/carboxylesterase; alpha/beta hydrola | 96.97 | |
| 1ycd_A | 243 | Hypothetical 27.3 kDa protein in AAP1-SMF2 interge | 96.9 | |
| 1gkl_A | 297 | Endo-1,4-beta-xylanase Y; hydrolase, esterase fami | 96.68 | |
| 2px6_A | 316 | Thioesterase domain; thioesaterse domain, orlistat | 96.68 | |
| 3c8d_A | 403 | Enterochelin esterase; alpha-beta-alpha sandwich, | 96.66 | |
| 2b9v_A | 652 | Alpha-amino acid ester hydrolase; catalytic triad, | 96.61 | |
| 4hvt_A | 711 | Ritya.17583.B, post-proline cleaving enzyme; ssgci | 96.6 | |
| 2qm0_A | 275 | BES; alpha-beta structure, structural genomics, PS | 96.59 | |
| 4f21_A | 246 | Carboxylesterase/phospholipase family protein; str | 96.47 | |
| 1tgl_A | 269 | Triacyl-glycerol acylhydrolase; carboxylic esteras | 96.41 | |
| 1tia_A | 279 | Lipase; hydrolase(carboxylic esterase); 2.10A {Pen | 96.18 | |
| 3guu_A | 462 | Lipase A; protein structure, hydrolase; HET: 1PE; | 95.9 | |
| 1tib_A | 269 | Lipase; hydrolase(carboxylic esterase); 1.84A {The | 95.63 | |
| 1qe3_A | 489 | PNB esterase, para-nitrobenzyl esterase; alpha-bet | 95.46 | |
| 1uwc_A | 261 | Feruloyl esterase A; hydrolase, serine esterase, x | 95.41 | |
| 1lgy_A | 269 | Lipase, triacylglycerol lipase; hydrolase (carboxy | 95.26 | |
| 2gzs_A | 278 | IROE protein; enterobactin, salmochelin, DFP, hydr | 95.16 | |
| 4ao6_A | 259 | Esterase; hydrolase, thermo label; 1.60A {Unidenti | 95.11 | |
| 2ogt_A | 498 | Thermostable carboxylesterase EST50; alpha/beta hy | 94.94 | |
| 3ngm_A | 319 | Extracellular lipase; secret lipase, hydrolase; 2. | 94.51 | |
| 3gff_A | 331 | IROE-like serine hydrolase; NP_718593.1, structura | 94.45 | |
| 3g7n_A | 258 | Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A | 94.04 | |
| 3o0d_A | 301 | YALI0A20350P, triacylglycerol lipase; alpha/beta-h | 93.7 | |
| 3uue_A | 279 | LIP1, secretory lipase (family 3); LID-domain, hyd | 93.36 | |
| 1whs_A | 255 | Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T | 93.16 | |
| 1ivy_A | 452 | Human protective protein; carboxypeptidase, serine | 93.04 | |
| 2fj0_A | 551 | JuvenIle hormone esterase; manduca sexta, alpha-be | 92.27 | |
| 2d81_A | 318 | PHB depolymerase; alpha/beta hydrolase fold, circu | 91.89 | |
| 2h7c_A | 542 | Liver carboxylesterase 1; enzyme, cholesteryl este | 91.82 | |
| 1p0i_A | 529 | Cholinesterase; serine hydrolase, butyrate, hydrol | 90.78 | |
| 3pic_A | 375 | CIP2; alpha/beta hydrolase fold, glucuronoyl ester | 90.17 | |
| 1ea5_A | 537 | ACHE, acetylcholinesterase; hydrolase, serine hydr | 89.83 | |
| 2ha2_A | 543 | ACHE, acetylcholinesterase; hydrolase fold, serine | 88.87 | |
| 4g4g_A | 433 | 4-O-methyl-glucuronoyl methylesterase; alpha/beta | 88.09 | |
| 3qpa_A | 197 | Cutinase; alpha-beta hydrolase fold, esterase, hyd | 87.4 | |
| 2bce_A | 579 | Cholesterol esterase; hydrolase, serine esterase, | 87.31 | |
| 2ory_A | 346 | Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph | 87.0 | |
| 1ukc_A | 522 | ESTA, esterase; fungi, A/B hydrolase fold, acetylc | 86.33 | |
| 1ac5_A | 483 | KEX1(delta)P; carboxypeptidase, hydrolase, glycopr | 85.8 | |
| 2yij_A | 419 | Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid | 85.11 | |
| 1llf_A | 534 | Lipase 3; candida cylindracea cholesterol esterase | 84.05 | |
| 1dx4_A | 585 | ACHE, acetylcholinesterase; hydrolase, serine este | 83.86 | |
| 3qpd_A | 187 | Cutinase 1; alpha-beta hydrolase fold, esterase, h | 83.42 | |
| 3bix_A | 574 | Neuroligin-1, neuroligin I; esterase domain, alpha | 83.17 | |
| 2vsq_A | 1304 | Surfactin synthetase subunit 3; ligase, peptidyl c | 83.14 | |
| 1qoz_A | 207 | AXE, acetyl xylan esterase; hydrolase, xylan degra | 83.07 | |
| 1g66_A | 207 | Acetyl xylan esterase II; serine hydrolase, acetyl | 83.02 | |
| 3dcn_A | 201 | Cutinase, cutin hydrolase; catalytic triad, secret | 81.54 | |
| 2czq_A | 205 | Cutinase-like protein; alpha/beta hydrolase fold, | 81.16 | |
| 4fol_A | 299 | FGH, S-formylglutathione hydrolase; D-type esteras | 80.69 | |
| 1thg_A | 544 | Lipase; hydrolase(carboxylic esterase); HET: NAG N | 80.43 | |
| 1cpy_A | 421 | Serine carboxypeptidase; hydrolase (carboxypeptida | 80.41 |
| >1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.8e-53 Score=440.73 Aligned_cols=224 Identities=38% Similarity=0.637 Sum_probs=200.9
Q ss_pred chhhhhhhhhcccccEEEEeccCCCccCCCcccccccHHHHHHHHHHHHHHHHHhcCCCcccEEEEEechHHHHHHHHHh
Q psy5002 142 VEDMILMAYLELHDYNIICVDWSNLASNRLYPLARWTIKYIGQHLADMLTTIERTTGYDWCMFHLVGHSLGAHVCGIAGE 221 (417)
Q Consensus 142 ~~~~ir~a~l~~~~~nVI~VDw~~~g~s~~Y~~a~~~~~~v~~~la~~l~~L~~~~~~~~~~ihlIGHSLGAhvAg~~g~ 221 (417)
|...+..+++..+++|||++||++++.+. |+.+..+++.++++|+++|+.|.++.+++++++||||||||||||+.+|+
T Consensus 87 w~~~l~~~ll~~~~~~VI~vD~~g~g~s~-y~~~~~~~~~~a~~l~~ll~~L~~~~g~~~~~v~LVGhSlGg~vA~~~a~ 165 (450)
T 1rp1_A 87 WLLDMCKNMFKVEEVNCICVDWKKGSQTS-YTQAANNVRVVGAQVAQMLSMLSANYSYSPSQVQLIGHSLGAHVAGEAGS 165 (450)
T ss_dssp HHHHHHHHHTTTCCEEEEEEECHHHHSSC-HHHHHHHHHHHHHHHHHHHHHHHHHHCCCGGGEEEEEETHHHHHHHHHHH
T ss_pred hHHHHHHHHHhcCCeEEEEEeCccccCCc-chHHHHHHHHHHHHHHHHHHHHHHhcCCChhhEEEEEECHhHHHHHHHHH
Confidence 34456777887778999999999999874 88888899999999999999996577889999999999999999999999
Q ss_pred hcCCCccceEEecCCCCCCCcC-CCCCCCCCCCCceEEEEEeCCC------cCceeccccceeeecCCCCcCCCCCCCC-
Q psy5002 222 NIAHGKIGRITGLDPALPLFSS-NITGRLDSTDATFVDIIHTCGG------YLGYYQPCGHVDFYPNGGTFIQPGCGWD- 293 (417)
Q Consensus 222 ~~~~~~i~rIt~LDpAgP~f~~-~~~~rL~~~dA~fVdvIHT~~~------~~G~~~~~Gh~DfypNgG~~~QPgC~~~- 293 (417)
++ ++ |+||++||||+|+|.. ....||+++||+|||+||||++ .+|+.+|+||+||||||| ..||||...
T Consensus 166 ~~-p~-v~~iv~Ldpa~p~f~~~~~~~rl~~~DA~~Vd~Iht~~~~~~~~~~~G~~~~~Gh~dfypNgG-~~QPgC~~~~ 242 (450)
T 1rp1_A 166 RT-PG-LGRITGLDPVEASFQGTPEEVRLDPTDADFVDVIHTDAAPLIPFLGFGTSQQMGHLDFFPNGG-EEMPGCKKNA 242 (450)
T ss_dssp TS-TT-CCEEEEESCCCTTTTTSCTTTSCCGGGSSEEEEECSCCSCHHHHCCCSCCSCCSSEEEEETTT-TCCTTCCCCC
T ss_pred hc-CC-cccccccCcccccccCCCchhccChhhcchhheeeccccccccccccCcCCcccceEeccCCC-CCCCCCCccc
Confidence 99 77 9999999999999987 7778999999999999999997 679999999999999999 799999841
Q ss_pred ----------------CCccccchhHHHHHhhccCCCCeEEeeCCCccccccCCcCCCC-ccccccccccCCCC------
Q psy5002 294 ----------------IGTCSHTRSYMFFTESIRTKIGFYARQCNSWSDYKKGHCKGSV-EDMILMGEHVNTSA------ 350 (417)
Q Consensus 294 ----------------~~~CsH~ra~~~~~eSi~~~~~f~a~~C~s~~~~~~~~C~~~~-~~~~~mG~~~~~~~------ 350 (417)
...|||.||++||+|||.++++|+|++|.||++|+.+.|.... ..|+.||+++++..
T Consensus 243 ~~~~~d~~~~~~~~~~~~~CsH~ra~~~f~eSi~~~~~f~a~~C~s~~~~~~~~C~~~~~~~~~~mG~~~~~~~~~~~~~ 322 (450)
T 1rp1_A 243 LSQIVDLDGIWEGTRDFVACNHLRSYKYYSESILNPDGFASYPCASYRAFESNKCFPCPDQGCPQMGHYADKFAVKTSDE 322 (450)
T ss_dssp CCSCCCHHHHHTTCSCCCCHHHHHHHHHHHHHHHCTTTTBCEECSCHHHHHTTCSCSCCTTCCCBSSGGGGGCC------
T ss_pred ccccccccccccccccccccCchhHHHHHHHHhccCCCceeeeCCCHHHHhCCCccCCCCCcccccCccCcccccccccc
Confidence 2479999999999999999999999999999999999998643 23899999988553
Q ss_pred ceeEEEecCCCCCCccccc
Q psy5002 351 RGKYYLMTASSKPYALGRY 369 (417)
Q Consensus 351 ~G~~yl~T~~~~Py~~~~~ 369 (417)
+|+|||+|++++||++.+|
T Consensus 323 ~g~~yl~T~~~~Pf~~~~Y 341 (450)
T 1rp1_A 323 TQKYFLNTGDSSNFARWRY 341 (450)
T ss_dssp -CEEEECCCSSSCCCCEEE
T ss_pred ceeEEecccccCCccccee
Confidence 8999999999999999876
|
| >1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 | Back alignment and structure |
|---|
| >1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} | Back alignment and structure |
|---|
| >1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* | Back alignment and structure |
|---|
| >1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A | Back alignment and structure |
|---|
| >1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 | Back alignment and structure |
|---|
| >1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A | Back alignment and structure |
|---|
| >1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* | Back alignment and structure |
|---|
| >1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} | Back alignment and structure |
|---|
| >1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A | Back alignment and structure |
|---|
| >2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* | Back alignment and structure |
|---|
| >1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A | Back alignment and structure |
|---|
| >3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... | Back alignment and structure |
|---|
| >2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} | Back alignment and structure |
|---|
| >1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A | Back alignment and structure |
|---|
| >1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* | Back alignment and structure |
|---|
| >1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 | Back alignment and structure |
|---|
| >1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* | Back alignment and structure |
|---|
| >2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* | Back alignment and structure |
|---|
| >1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* | Back alignment and structure |
|---|
| >1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A | Back alignment and structure |
|---|
| >3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A | Back alignment and structure |
|---|
| >1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A | Back alignment and structure |
|---|
| >1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* | Back alignment and structure |
|---|
| >3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A | Back alignment and structure |
|---|
| >2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A | Back alignment and structure |
|---|
| >1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A | Back alignment and structure |
|---|
| >3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} | Back alignment and structure |
|---|
| >3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* | Back alignment and structure |
|---|
| >1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* | Back alignment and structure |
|---|
| >3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* | Back alignment and structure |
|---|
| >1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A | Back alignment and structure |
|---|
| >3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A | Back alignment and structure |
|---|
| >3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} | Back alignment and structure |
|---|
| >3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A | Back alignment and structure |
|---|
| >1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A | Back alignment and structure |
|---|
| >1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 | Back alignment and structure |
|---|
| >3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A | Back alignment and structure |
|---|
| >1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* | Back alignment and structure |
|---|
| >1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 | Back alignment and structure |
|---|
| >1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A | Back alignment and structure |
|---|
| >2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A | Back alignment and structure |
|---|
| >3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} | Back alignment and structure |
|---|
| >3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A | Back alignment and structure |
|---|
| >3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P | Back alignment and structure |
|---|
| >2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* | Back alignment and structure |
|---|
| >3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A | Back alignment and structure |
|---|
| >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A | Back alignment and structure |
|---|
| >3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* | Back alignment and structure |
|---|
| >3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} | Back alignment and structure |
|---|
| >1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A | Back alignment and structure |
|---|
| >1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 | Back alignment and structure |
|---|
| >2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} | Back alignment and structure |
|---|
| >3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A | Back alignment and structure |
|---|
| >3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A | Back alignment and structure |
|---|
| >3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* | Back alignment and structure |
|---|
| >2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A | Back alignment and structure |
|---|
| >4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A | Back alignment and structure |
|---|
| >3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* | Back alignment and structure |
|---|
| >3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A | Back alignment and structure |
|---|
| >3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A | Back alignment and structure |
|---|
| >1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* | Back alignment and structure |
|---|
| >4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} | Back alignment and structure |
|---|
| >1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* | Back alignment and structure |
|---|
| >2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* | Back alignment and structure |
|---|
| >3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A | Back alignment and structure |
|---|
| >1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A | Back alignment and structure |
|---|
| >2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* | Back alignment and structure |
|---|
| >3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* | Back alignment and structure |
|---|
| >3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} | Back alignment and structure |
|---|
| >1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 | Back alignment and structure |
|---|
| >2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 | Back alignment and structure |
|---|
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* | Back alignment and structure |
|---|
| >1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* | Back alignment and structure |
|---|
| >2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* | Back alignment and structure |
|---|
| >2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 | Back alignment and structure |
|---|
| >2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E | Back alignment and structure |
|---|
| >3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* | Back alignment and structure |
|---|
| >2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 | Back alignment and structure |
|---|
| >2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} | Back alignment and structure |
|---|
| >2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* | Back alignment and structure |
|---|
| >3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} | Back alignment and structure |
|---|
| >3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A | Back alignment and structure |
|---|
| >2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 | Back alignment and structure |
|---|
| >1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A | Back alignment and structure |
|---|
| >3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 | Back alignment and structure |
|---|
| >3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} | Back alignment and structure |
|---|
| >1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* | Back alignment and structure |
|---|
| >2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} | Back alignment and structure |
|---|
| >1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A | Back alignment and structure |
|---|
| >1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A | Back alignment and structure |
|---|
| >3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* | Back alignment and structure |
|---|
| >3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A | Back alignment and structure |
|---|
| >1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 | Back alignment and structure |
|---|
| >1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* | Back alignment and structure |
|---|
| >3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} | Back alignment and structure |
|---|
| >2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* | Back alignment and structure |
|---|
| >3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A | Back alignment and structure |
|---|
| >3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A | Back alignment and structure |
|---|
| >3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} | Back alignment and structure |
|---|
| >2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A | Back alignment and structure |
|---|
| >2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 | Back alignment and structure |
|---|
| >2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A | Back alignment and structure |
|---|
| >1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* | Back alignment and structure |
|---|
| >3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} | Back alignment and structure |
|---|
| >3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A | Back alignment and structure |
|---|
| >2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* | Back alignment and structure |
|---|
| >3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A | Back alignment and structure |
|---|
| >2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A | Back alignment and structure |
|---|
| >4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A | Back alignment and structure |
|---|
| >2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A | Back alignment and structure |
|---|
| >3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A | Back alignment and structure |
|---|
| >1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* | Back alignment and structure |
|---|
| >3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* | Back alignment and structure |
|---|
| >3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* | Back alignment and structure |
|---|
| >3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A | Back alignment and structure |
|---|
| >3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} | Back alignment and structure |
|---|
| >1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 | Back alignment and structure |
|---|
| >1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* | Back alignment and structure |
|---|
| >3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A | Back alignment and structure |
|---|
| >4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A | Back alignment and structure |
|---|
| >1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* | Back alignment and structure |
|---|
| >3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* | Back alignment and structure |
|---|
| >1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* | Back alignment and structure |
|---|
| >2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* | Back alignment and structure |
|---|
| >2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A | Back alignment and structure |
|---|
| >4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} | Back alignment and structure |
|---|
| >2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A | Back alignment and structure |
|---|
| >1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* | Back alignment and structure |
|---|
| >1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* | Back alignment and structure |
|---|
| >1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A | Back alignment and structure |
|---|
| >1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* | Back alignment and structure |
|---|
| >1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A | Back alignment and structure |
|---|
| >2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* | Back alignment and structure |
|---|
| >4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A | Back alignment and structure |
|---|
| >2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A | Back alignment and structure |
|---|
| >3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} | Back alignment and structure |
|---|
| >3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} | Back alignment and structure |
|---|
| >3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* | Back alignment and structure |
|---|
| >1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* | Back alignment and structure |
|---|
| >1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 | Back alignment and structure |
|---|
| >2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} | Back alignment and structure |
|---|
| >2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* | Back alignment and structure |
|---|
| >2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* | Back alignment and structure |
|---|
| >1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... | Back alignment and structure |
|---|
| >3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... | Back alignment and structure |
|---|
| >2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... | Back alignment and structure |
|---|
| >4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* | Back alignment and structure |
|---|
| >3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... | Back alignment and structure |
|---|
| >2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A | Back alignment and structure |
|---|
| >2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} | Back alignment and structure |
|---|
| >1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 | Back alignment and structure |
|---|
| >2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* | Back alignment and structure |
|---|
| >1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* | Back alignment and structure |
|---|
| >3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A | Back alignment and structure |
|---|
| >3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* | Back alignment and structure |
|---|
| >2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 | Back alignment and structure |
|---|
| >1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* | Back alignment and structure |
|---|
| >3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* | Back alignment and structure |
|---|
| >2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} | Back alignment and structure |
|---|
| >4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* | Back alignment and structure |
|---|
| >1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 417 | ||||
| d1bu8a2 | 338 | c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal | 2e-64 | |
| d1bu8a2 | 338 | c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal | 4e-21 | |
| d1rp1a2 | 337 | c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal | 1e-60 | |
| d1rp1a2 | 337 | c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal | 2e-19 |
| >d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 338 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Pancreatic lipase, N-terminal domain domain: Pancreatic lipase, N-terminal domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 207 bits (528), Expect = 2e-64
Identities = 81/261 (31%), Positives = 115/261 (44%), Gaps = 34/261 (13%)
Query: 136 GHCKGSVEDMILMAYLELHDYNIICVDWSNLASNRLYPLARWTIKYIGQHLADMLTTIER 195
+ + ++ N ICVDW + Y A + + +G +A ++ +
Sbjct: 81 DKGEDGWLLDMCKKMFQVEKVNCICVDWRRGSRT-EYTQASYNTRVVGAEIAFLVQVLST 139
Query: 196 TTGYDWCMFHLVGHSLGAHVCGIAGENIAHGKIGRITGLDPALPLFSSNITG-RLDSTDA 254
GY HL+GHSLGAHV G AG + G +GRITGLDPA P F RLD +DA
Sbjct: 140 EMGYSPENVHLIGHSLGAHVVGEAGRRL-EGHVGRITGLDPAEPCFQGLPEEVRLDPSDA 198
Query: 255 TFVDIIHTCGGYL------GYYQPCGHVDFYPNGGTFIQPGCGWDIG------------- 295
FVD+IHT + G Q GH+DF+PNGG PGC +I
Sbjct: 199 MFVDVIHTDSAPIIPYLGFGMSQKVGHLDFFPNGGKE-MPGCQKNILSTIVDINGIWEGT 257
Query: 296 ----TCSHTRSYMFFTESIRTKIGFYARQCNSWSDYKKGHCKGSVEDM-ILMGEHVN--- 347
C+H RSY ++ SI GF C+S+ +++ C E+ MG + +
Sbjct: 258 QNFVACNHLRSYKYYASSILNPDGFLGYPCSSYEKFQQNDCFPCPEEGCPKMGHYADQFE 317
Query: 348 ---TSARGKYYLMTASSKPYA 365
+ YL T S +
Sbjct: 318 GKTATVEQTVYLNTGDSGNFT 338
|
| >d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 338 | Back information, alignment and structure |
|---|
| >d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Length = 337 | Back information, alignment and structure |
|---|
| >d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Length = 337 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 417 | |||
| d1bu8a2 | 338 | Pancreatic lipase, N-terminal domain {Rat (Rattus | 100.0 | |
| d1rp1a2 | 337 | Pancreatic lipase, N-terminal domain {Dog (Canis f | 100.0 | |
| d1bu8a2 | 338 | Pancreatic lipase, N-terminal domain {Rat (Rattus | 99.98 | |
| d1rp1a2 | 337 | Pancreatic lipase, N-terminal domain {Dog (Canis f | 99.98 | |
| d3c70a1 | 256 | Hydroxynitrile lyase {Rubber tree (Hevea brasilien | 99.22 | |
| d1mtza_ | 290 | Tricorn interacting factor F1 {Archaeon Thermoplas | 99.16 | |
| d1q0ra_ | 297 | Aclacinomycin methylesterase RdmC {Streptomyces pu | 99.11 | |
| d1b6ga_ | 310 | Haloalkane dehalogenase {Xanthobacter autotrophicu | 99.1 | |
| d1brta_ | 277 | Bromoperoxidase A2 {Streptomyces aureofaciens [Tax | 99.09 | |
| d1pjaa_ | 268 | Palmitoyl protein thioesterase 2 {Human (Homo sapi | 99.07 | |
| d1hkha_ | 279 | Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] | 99.07 | |
| d1ehya_ | 293 | Bacterial epoxide hydrolase {Agrobacterium radioba | 99.06 | |
| d1bn7a_ | 291 | Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 | 99.01 | |
| d1a8qa_ | 274 | Bromoperoxidase A1 {Streptomyces aureofaciens [Tax | 99.01 | |
| d1xkla_ | 258 | Salicylic acid-binding protein 2 (SABP2) {Common t | 99.01 | |
| d2rhwa1 | 283 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 99.0 | |
| d1zd3a2 | 322 | Mammalian epoxide hydrolase, C-terminal domain {Hu | 99.0 | |
| d1c4xa_ | 281 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 98.98 | |
| d1uk8a_ | 271 | Meta-cleavage product hydrolase CumD {Pseudomonas | 98.97 | |
| d1j1ia_ | 268 | Meta cleavage compound hydrolase CarC {Janthinobac | 98.91 | |
| d1a88a_ | 275 | Chloroperoxidase L {Streptomyces lividans [TaxId: | 98.88 | |
| d1azwa_ | 313 | Proline iminopeptidase {Xanthomonas campestris, pv | 98.87 | |
| d1va4a_ | 271 | Arylesterase {Pseudomonas fluorescens [TaxId: 294] | 98.83 | |
| d1imja_ | 208 | Ccg1/TafII250-interacting factor B (Cib) {Human (H | 98.8 | |
| d1mj5a_ | 298 | Haloalkane dehalogenase {Sphingomonas paucimobilis | 98.78 | |
| d1a8sa_ | 273 | Chloroperoxidase F {Pseudomonas fluorescens [TaxId | 98.78 | |
| d1r3da_ | 264 | Hypothetical protein VC1974 {Vibrio cholerae [TaxI | 98.74 | |
| d1ispa_ | 179 | Lipase A {Bacillus subtilis [TaxId: 1423]} | 98.74 | |
| d1m33a_ | 256 | Biotin biosynthesis protein BioH {Escherichia coli | 98.65 | |
| d1k8qa_ | 377 | Gastric lipase {Dog (Canis familiaris) [TaxId: 961 | 98.6 | |
| d2dsta1 | 122 | Hypothetical protein TTHA1544 {Thermus thermophilu | 98.54 | |
| d1thta_ | 302 | Myristoyl-ACP-specific thioesterase {Vibrio harvey | 98.51 | |
| d1cvla_ | 319 | Lipase {Chromobacterium viscosum [TaxId: 42739]} | 98.45 | |
| d1tqha_ | 242 | Carboxylesterase Est {Bacillus stearothermophilus | 98.41 | |
| d1ex9a_ | 285 | Lipase {Pseudomonas aeruginosa [TaxId: 287]} | 98.35 | |
| d1wm1a_ | 313 | Proline aminopeptidase {Serratia marcescens [TaxId | 98.33 | |
| d1xkta_ | 286 | Fatty acid synthase {Human (Homo sapiens) [TaxId: | 98.32 | |
| d2h7xa1 | 283 | Picromycin polyketide synthase {Streptomyces venez | 98.15 | |
| d1uxoa_ | 186 | Hypothetical protein YdeN {Bacillus subtilis [TaxI | 98.14 | |
| d2jbwa1 | 360 | 2,6-dihydropseudooxynicotine hydrolase {Arthrobact | 98.11 | |
| d1tcaa_ | 317 | Triacylglycerol lipase {Yeast (Candida antarctica) | 98.07 | |
| d2fuka1 | 218 | XC6422 protein {Xanthomonas campestris [TaxId: 339 | 97.95 | |
| d1qo7a_ | 394 | Bacterial epoxide hydrolase {Aspergillus niger [Ta | 97.95 | |
| d1mo2a_ | 255 | Erythromycin polyketide synthase {Saccharopolyspor | 97.94 | |
| d1jmkc_ | 230 | Surfactin synthetase, SrfA {Bacillus subtilis [Tax | 97.9 | |
| d1ei9a_ | 279 | Palmitoyl protein thioesterase 1 {Cow (Bos taurus) | 97.63 | |
| d1fj2a_ | 229 | Acyl protein thioesterase 1 {Human (Homo sapiens) | 97.56 | |
| d2vata1 | 376 | Acetyl-CoA:deacetylcephalosporin C acetyltransfera | 97.51 | |
| d3b5ea1 | 209 | Uncharacterized protein Mll8374 {Mesorhizobium lot | 97.41 | |
| d2pl5a1 | 362 | Homoserine O-acetyltransferase {Leptospira interro | 97.38 | |
| d2b61a1 | 357 | Homoserine O-acetyltransferase {Haemophilus influe | 97.38 | |
| d1ufoa_ | 238 | Hypothetical protein TT1662 {Thermus thermophilus | 97.18 | |
| d1vkha_ | 263 | Putative serine hydrolase Ydr428c {Baker's yeast ( | 96.93 | |
| d1sfra_ | 288 | Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 | 96.88 | |
| d1xfda2 | 258 | Dipeptidyl aminopeptidase-like protein 6, DPP6, C- | 96.8 | |
| d1jfra_ | 260 | Lipase {Streptomyces exfoliatus [TaxId: 1905]} | 96.79 | |
| d1r88a_ | 267 | Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta | 96.79 | |
| d1dqza_ | 280 | Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 | 96.71 | |
| d1l7aa_ | 318 | Cephalosporin C deacetylase {Bacillus subtilis [Ta | 96.56 | |
| d2h1ia1 | 202 | Carboxylesterase {Bacillus cereus [TaxId: 1396]} | 96.54 | |
| d1auoa_ | 218 | Carboxylesterase {Pseudomonas fluorescens [TaxId: | 96.45 | |
| d2pbla1 | 261 | Uncharacterized protein TM1040_2492 {Silicibacter | 96.32 | |
| d2i3da1 | 218 | Hypothetical protein Atu1826 {Agrobacterium tumefa | 96.25 | |
| d2hu7a2 | 260 | Acylamino-acid-releasing enzyme, C-terminal donain | 96.18 | |
| d2bgra2 | 258 | Dipeptidyl peptidase IV/CD26, C-terminal domain {P | 96.14 | |
| d1vlqa_ | 322 | Acetyl xylan esterase TM0077 {Thermotoga maritima | 96.09 | |
| d1lzla_ | 317 | Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | 96.06 | |
| d1mpxa2 | 381 | Alpha-amino acid ester hydrolase {Xanthomonas citr | 95.99 | |
| d1ku0a_ | 388 | Lipase L1 {Bacillus stearothermophilus [TaxId: 142 | 95.93 | |
| d2r8ba1 | 203 | Uncharacterized protein Atu2452 {Agrobacterium tum | 95.64 | |
| d1jjia_ | 311 | Carboxylesterase {Archaeon Archaeoglobus fulgidus | 95.6 | |
| d2b9va2 | 385 | Alpha-amino acid ester hydrolase {Acetobacter past | 95.53 | |
| d1ju3a2 | 347 | Bacterial cocaine esterase N-terminal domain {Rhod | 95.46 | |
| d1jjfa_ | 255 | Feruloyl esterase domain of the cellulosomal xylan | 95.44 | |
| d3c8da2 | 246 | Enterochelin esterase, catalytic domain {Shigella | 95.43 | |
| d1lnsa3 | 405 | X-Prolyl dipeptidyl aminopeptidase PepX, middle do | 94.97 | |
| d1dina_ | 233 | Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI | 94.52 | |
| d1lgya_ | 265 | Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 | 94.33 | |
| d1uwca_ | 261 | Feruloyl esterase A {Aspergillus niger [TaxId: 506 | 94.28 | |
| d1tiba_ | 269 | Triacylglycerol lipase {Thermomyces lanuginosus, f | 94.22 | |
| d3tgla_ | 265 | Triacylglycerol lipase {Rhizomucor miehei [TaxId: | 94.1 | |
| d1tiaa_ | 271 | Triacylglycerol lipase {Penicillium camembertii [T | 93.93 | |
| d1jkma_ | 358 | Carboxylesterase {Bacillus subtilis, brefeldin A e | 93.55 | |
| d1u4na_ | 308 | Carboxylesterase {Alicyclobacillus acidocaldarius | 93.52 | |
| d1qlwa_ | 318 | A novel bacterial esterase {Alcaligenes sp. [TaxId | 92.69 | |
| d1wb4a1 | 273 | Feruloyl esterase domain of the cellulosomal xylan | 91.62 | |
| d2d81a1 | 318 | Polyhydroxybutyrate depolymerase {Penicillium funi | 90.99 | |
| d1cexa_ | 197 | Cutinase {Fungus (Fusarium solani), subsp. pisi [T | 89.77 | |
| d1ivya_ | 452 | Human 'protective protein', HPP {Human (Homo sapie | 86.76 | |
| d1pv1a_ | 299 | Hypothetical esterase YJL068C {Baker's yeast (Sacc | 86.52 | |
| d2gzsa1 | 265 | Enterobactin and salmochelin hydrolase IroE {Esche | 84.76 |
| >d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Pancreatic lipase, N-terminal domain domain: Pancreatic lipase, N-terminal domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00 E-value=2.8e-67 Score=519.68 Aligned_cols=224 Identities=36% Similarity=0.641 Sum_probs=204.9
Q ss_pred cCcchhhhhhhhhcccccEEEEeccCCCccCCCcccccccHHHHHHHHHHHHHHHHHhcCCCcccEEEEEechHHHHHHH
Q psy5002 139 KGSVEDMILMAYLELHDYNIICVDWSNLASNRLYPLARWTIKYIGQHLADMLTTIERTTGYDWCMFHLVGHSLGAHVCGI 218 (417)
Q Consensus 139 ~~s~~~~ir~a~l~~~~~nVI~VDw~~~g~s~~Y~~a~~~~~~v~~~la~~l~~L~~~~~~~~~~ihlIGHSLGAhvAg~ 218 (417)
...|...++++|++.+++|||+|||+..+.. .|.+++.+++.||+.||+||+.|.++.+++++++|||||||||||||+
T Consensus 84 ~~~~~~~~~~a~l~~~d~NVi~VDW~~~a~~-~Y~~a~~n~~~Vg~~ia~~i~~l~~~~g~~~~~vhlIGhSLGAhiaG~ 162 (338)
T d1bu8a2 84 EDGWLLDMCKKMFQVEKVNCICVDWRRGSRT-EYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGAHVVGE 162 (338)
T ss_dssp CTTHHHHHHHHHHTTCCEEEEEEECHHHHSS-CHHHHHHHHHHHHHHHHHHHHHHHHHHCCCGGGEEEEEETHHHHHHHH
T ss_pred CcccHHHHHHHHHhcCCceEEEEechhhccc-chHHHHHhHHHHHHHHHHHHHHHHHhcCCCcceeEEEeccHHHHHHHH
Confidence 3456778999999999999999999998865 799999999999999999999987888999999999999999999999
Q ss_pred HHhhcCCCccceEEecCCCCCCCcC-CCCCCCCCCCCceEEEEEeCCCc------CceeccccceeeecCCCCcCCCCCC
Q psy5002 219 AGENIAHGKIGRITGLDPALPLFSS-NITGRLDSTDATFVDIIHTCGGY------LGYYQPCGHVDFYPNGGTFIQPGCG 291 (417)
Q Consensus 219 ~g~~~~~~~i~rIt~LDpAgP~f~~-~~~~rL~~~dA~fVdvIHT~~~~------~G~~~~~Gh~DfypNgG~~~QPgC~ 291 (417)
+|+++ .+||+||||||||+|+|+. ++..|||++||+||||||||++. +|+..|+||+||||||| ..||||.
T Consensus 163 ag~~l-~~kigrItgLDPA~P~F~~~~~~~rLd~~DA~fVdVIHT~~g~l~~~~~~G~~~p~GhvDFYpNGG-~~QPgC~ 240 (338)
T d1bu8a2 163 AGRRL-EGHVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHLDFFPNGG-KEMPGCQ 240 (338)
T ss_dssp HHHHT-TTCSSEEEEESCBCTTTTTSCGGGSCCGGGSSSEEEECSCCSCHHHHCCCBCCSCCSSEEEEETTS-SCCTTCC
T ss_pred HHHhh-ccccccccccccCcCcccCCchhcCcCcccCCeEEEEEeCCccccccccCCccCCcCCeeeccCCC-ccCCCCC
Confidence 99999 6799999999999999998 78889999999999999999975 59999999999999999 8899997
Q ss_pred CC-----------------CCccccchhHHHHHhhccCCCCeEEeeCCCccccccCCcCCCC-ccccccccccCC-----
Q psy5002 292 WD-----------------IGTCSHTRSYMFFTESIRTKIGFYARQCNSWSDYKKGHCKGSV-EDMILMGEHVNT----- 348 (417)
Q Consensus 292 ~~-----------------~~~CsH~ra~~~~~eSi~~~~~f~a~~C~s~~~~~~~~C~~~~-~~~~~mG~~~~~----- 348 (417)
.. ...|||.||++||+|||.++++|+|++|+||++|+.+.|..++ ..|..|||++++
T Consensus 241 ~~~~~~~~~~~~~~~~~~~~~~CsH~ra~~yf~ESI~~~~~F~a~~C~s~~~~~~g~C~~c~~~~~~~MG~~a~~~~~~~ 320 (338)
T d1bu8a2 241 KNILSTIVDINGIWEGTQNFVACNHLRSYKYYASSILNPDGFLGYPCSSYEKFQQNDCFPCPEEGCPKMGHYADQFEGKT 320 (338)
T ss_dssp CCCCCSCCCHHHHHTTSSCCCCHHHHHHHHHHHHHHHCGGGCBCEECSCHHHHHTTCSCSCCTTCCCBSSGGGGGCTTTT
T ss_pred cchhhccccccccccccccccccchHHHHHHHHHHhcCCCCceeeeCCCHHHHHhCCCCCCCCCCCCccCcccccccCCC
Confidence 52 1369999999999999999999999999999999999996432 238999998864
Q ss_pred -CCceeEEEecCCCCCCc
Q psy5002 349 -SARGKYYLMTASSKPYA 365 (417)
Q Consensus 349 -~~~G~~yl~T~~~~Py~ 365 (417)
.++|+|||.|++++||+
T Consensus 321 ~~~~G~yyl~T~~~~Pfa 338 (338)
T d1bu8a2 321 ATVEQTVYLNTGDSGNFT 338 (338)
T ss_dssp SSSSEEEEECCCSSTTCC
T ss_pred CCcceEEEEecCCCCcCC
Confidence 47899999999999996
|
| >d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} | Back information, alignment and structure |
|---|
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} | Back information, alignment and structure |
|---|
| >d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} | Back information, alignment and structure |
|---|
| >d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} | Back information, alignment and structure |
|---|
| >d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} | Back information, alignment and structure |
|---|
| >d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} | Back information, alignment and structure |
|---|
| >d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} | Back information, alignment and structure |
|---|
| >d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} | Back information, alignment and structure |
|---|
| >d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} | Back information, alignment and structure |
|---|
| >d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} | Back information, alignment and structure |
|---|
| >d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} | Back information, alignment and structure |
|---|
| >d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} | Back information, alignment and structure |
|---|
| >d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} | Back information, alignment and structure |
|---|
| >d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} | Back information, alignment and structure |
|---|
| >d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} | Back information, alignment and structure |
|---|
| >d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|