Diaphorina citri psyllid: psy5005


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MDGLRVNLDMGKAFYSWSMQRDPDMKDTVVRSTTIPEELGRISYLLSDKTGTLTQNSMVFRKLHLGTVSYGPDTFDEVRDLLKFTYENMSATADSNTPHKQMVIGSNKIRRSDHKPGTVSLPVSV
ccCEEEEHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEcccccccccEEEEEcEEEccEEcccccHHHHHHHHHHHHHcccccccccccccccccccccEEEcccccccccccccc
*DGLRVNLDMGKAFYSWSMQRDPDMKDTVVRSTTIPEELGRISYLLSDKTGTLTQNSMVFRKLHLGTVSYGPDTFDEVRDLLKFTYE*********************************LPV**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGLRVNLDMGKAFYSWSMQRDPDMKDTVVRSTTIPEELGRISYLLSDKTGTLTQNSMVFRKLHLGTVSYGPDTFDEVRDLLKFTYENMSATADSNTPHKQMVIGSNKIRRSDHKPGTVSLPVSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable phospholipid-transporting ATPase IIA confidentO70228
Probable phospholipid-transporting ATPase IIB confidentF1Q4S1
Probable phospholipid-transporting ATPase NEO1 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of phospholipids (Potential). Leads to neomycin-resistance when overexpressed. Required for traffic between late Golgi and early endosomes.confidentP40527

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0005769 [CC]early endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0055037 [CC]recycling endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0019829 [MF]cation-transporting ATPase activityprobableGO:0003674, GO:0016887, GO:0042625, GO:0042626, GO:0016820, GO:0042623, GO:0015399, GO:0022804, GO:0016787, GO:0005215, GO:0008324, GO:0017111, GO:0003824, GO:0022891, GO:0016818, GO:0022892, GO:0043492, GO:0016817, GO:0015075, GO:0016462, GO:0022857, GO:0015405
GO:0051234 [BP]establishment of localizationprobableGO:0008150, GO:0051179
GO:0051641 [BP]cellular localizationprobableGO:0008150, GO:0009987, GO:0044763, GO:0051179, GO:0044699
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0030137 [CC]COPI-coated vesicleprobableGO:0005737, GO:0005794, GO:0043231, GO:0043229, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0005798, GO:0005623, GO:0031988, GO:0044446, GO:0044431, GO:0043227, GO:0005575, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0044422, GO:0031982
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0004012 [MF]phospholipid-translocating ATPase activityprobableGO:0005548, GO:0005319, GO:0016818, GO:0022892, GO:0042623, GO:0005215, GO:0043492, GO:0016787, GO:0017111, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0016887
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IXZ, chain A
Confidence level:very confident
Coverage over the Query: 3-70
View the alignment between query and template
View the model in PyMOL
Template: 2YJ3, chain A
Confidence level:probable
Coverage over the Query: 27-91
View the alignment between query and template
View the model in PyMOL