Diaphorina citri psyllid: psy5010

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18

MGFWLGVDQEDLAGSFSISGTVYGVIASASLALYSIHTKKVLPCVNNEIWLLSYYNNVYSSIILLFVSGLFGELKTVQDYADLNTAYFWLFLPIGGLCGFAIGYVTTLQIKITSPLTHNISGTAKACAQTVIASYWYNEVKPFLWWVSNWVVLFGSAAYTFVKQREMEAQYNNKYSRV

ccEEEEECcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEHHHHcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc

MGFWLGVDQEDLAGSFSISGTVYGVIASASLALYSIHTKKVLPCVNNEIWLLSYYNNVYSSIILLFVSGLFGELKTVQDYADLNTAYFWLFLPIGGLCGFAIGYVTTLQIKITSPLTHNISGTAKACAQTVIASYWYNEVKPFLWWVSNWVVLFGSAAYTFVKQ**************

xxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGFWLGVDQEDLAGSFSISGTVYGVIASASLALYSIHTKKVLPCVNNEIWLLSYYNNVYSSIILLFVSGLFGELKTVQDYADLNTAYFWLFLPIGGLCGFAIGYVTTLQIKITSPLTHNISGTAKACAQTVIASYWYNEVKPFLWWVSNWVVLFGSAAYTFVKQREMEAQYNNKYSRV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
GDP-fucose transporter	Involved in GDP-fucose import from the cytoplasm into the Golgi lumen.	confident	Q968A5
GDP-fucose transporter 1	Involved in GDP-fucose import from the cytoplasm into the Golgi lumen.	confident	A6QM03
GDP-fucose transporter 1	Involved in GDP-fucose import from the cytoplasm into the Golgi lumen.	confident	Q96A29

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0009987 [BP]	cellular process	probable	GO:0008150

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 94-162
View the alignment between query and template
View the model in PyMOL