Diaphorina citri psyllid: psy5015


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MDGYACGLKQDQFVLREDGYGQVVGRIKDMIIRGGENIYPKEIEEFIQTHPNVLEAYAYGVPDERMGEEVGISIKLKENAKLNADDIRTFCKGK
cccccccccccCEEEcccccEEEEcccccEEEEccccccHHHHHHHHHHcccccEEEEEEEccccccEEEEEEEEEcccccccHHHHHHHHccc
MDGYACGLKQDQFVLREDGYGQVVGRIKDMIIRGGENIYPKEIEEFIQTHPNVLEAYAYGVPDERMGEEVGISIKLKENAKLNADDIRTFCKG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGYACGLKQDQFVLREDGYGQVVGRIKDMIIRGGENIYPKEIEEFIQTHPNVLEAYAYGVPDERMGEEVGISIKLKENAKLNADDIRTFCKGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acyl-CoA synthetase family member 2, mitochondrial Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. Has some preference toward medium-chain substrates. Plays a role in adipodyte differentiation.confidentQ0P4F7
Acyl-CoA synthetase family member 2, mitochondrial Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. Has some preference toward medium-chain substrates. Plays a role in adipodyte differentiation.confidentQ5R9G9
Acyl-CoA synthetase family member 2, mitochondrial Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. Has some preference toward medium-chain substrates. Plays a role in adipodyte differentiation.confidentQ96CM8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005777 [CC]peroxisomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0004321 [MF]fatty-acyl-CoA synthase activityprobableGO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0003674, GO:0016408
GO:0015645 [MF]fatty acid ligase activityprobableGO:0003824, GO:0003674, GO:0016874, GO:0016877
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0071616 [BP]acyl-CoA biosynthetic processprobableGO:1901576, GO:0035383, GO:0051186, GO:0006637, GO:0035384, GO:0071704, GO:0006732, GO:0009987, GO:0051188, GO:0044237, GO:0044249, GO:0009058, GO:0009108, GO:0008152, GO:0006793, GO:0008150
GO:0046395 [BP]carboxylic acid catabolic processprobableGO:0044712, GO:1901575, GO:0008152, GO:0006082, GO:0044237, GO:0016054, GO:0009987, GO:0044710, GO:0019752, GO:0044248, GO:0071704, GO:0008150, GO:0044281, GO:0044282, GO:0043436, GO:0009056
GO:0006633 [BP]fatty acid biosynthetic processprobableGO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0047760 [MF]butyrate-CoA ligase activityprobableGO:0016878, GO:0003824, GO:0003674, GO:0016874, GO:0016877
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046459 [BP]short-chain fatty acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0018861 [MF]4-chlorobenzoate-CoA ligase activityprobableGO:0016878, GO:0016405, GO:0003824, GO:0003674, GO:0016874, GO:0016877
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FUQ, chain A
Confidence level:very confident
Coverage over the Query: 1-94
View the alignment between query and template
View the model in PyMOL