Diaphorina citri psyllid: psy5037


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
ETLNLNKRSEREAKLATTEIDRFKYELNNLELERNRAQSEVRRLQTELYDMNQHNMTIQQELEASRTEAEDVKLQLQHYCCEVQRIEEILSKKESERLDLLKHLKFISQETAELENNNHSLDGEMKSCKNLLAESEKKVMKLEALVQDKDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYRLGEELAGCQETLDTMLRQKEELRLQLADTENYKTKESAPMA
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
**********************FKYEL********************************************VKLQLQHYCCEVQRIEEILSK****RLDLLKHLKFI**********************************LEALVQDKDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYRLGEELAGCQETLD****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ETLNLNKRSERExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLQHYCCEVQRIEEILSKKESERLDLLKHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVQDKDCSxxxxxxxxxxxxxxxxxxxxxxxxxxxxKYRLGEExxxxxxxxxxxxxxxxxxxxxxxxxxxxKTKESAPMA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032432 [CC]actin filament bundleprobableGO:0005856, GO:0005575, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043226, GO:0044422
GO:0000142 [CC]cellular bud neck contractile ringprobableGO:0015629, GO:0030427, GO:0043229, GO:0071944, GO:0070938, GO:0043226, GO:0005856, GO:0005575, GO:0044430, GO:0005737, GO:0032153, GO:0032155, GO:0005938, GO:0005935, GO:0005933, GO:0005826, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0043228, GO:0044448, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 10-56
View the alignment between query and template
View the model in PyMOL
Template: 1C1G, chain A
Confidence level:confident
Coverage over the Query: 149-216
View the alignment between query and template
View the model in PyMOL
Template: 3NA7, chain A
Confidence level:probable
Coverage over the Query: 25-187
View the alignment between query and template
View the model in PyMOL