Psyllid ID: psy5037
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 224 | ||||||
| 328791605 | 397 | PREDICTED: centrosomal protein of 135 kD | 0.892 | 0.503 | 0.36 | 2e-23 | |
| 380017057 | 676 | PREDICTED: centrosomal protein of 135 kD | 0.919 | 0.304 | 0.354 | 6e-23 | |
| 328713843 | 1032 | PREDICTED: hypothetical protein LOC10016 | 0.883 | 0.191 | 0.380 | 1e-22 | |
| 345484545 | 868 | PREDICTED: centrosomal protein of 135 kD | 0.933 | 0.240 | 0.349 | 1e-22 | |
| 332026529 | 393 | Centrosomal protein of 135 kDa [Acromyrm | 0.825 | 0.470 | 0.372 | 2e-22 | |
| 350417848 | 1119 | PREDICTED: hypothetical protein LOC10074 | 0.933 | 0.186 | 0.334 | 8e-21 | |
| 307208304 | 446 | Centrosomal protein of 135 kDa [Harpegna | 0.857 | 0.430 | 0.354 | 1e-20 | |
| 242005075 | 1136 | hypothetical protein Phum_PHUM055770 [Pe | 0.848 | 0.167 | 0.368 | 2e-19 | |
| 307167225 | 388 | Centrosomal protein of 135 kDa [Camponot | 0.825 | 0.476 | 0.356 | 8e-17 | |
| 357608405 | 297 | putative centrosomal protein 135 [Danaus | 0.633 | 0.478 | 0.394 | 8e-15 |
| >gi|328791605|ref|XP_003251598.1| PREDICTED: centrosomal protein of 135 kDa-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
Score = 115 bits (287), Expect = 2e-23, Method: Compositional matrix adjust.
Identities = 72/200 (36%), Positives = 117/200 (58%)
Query: 19 EIDRFKYELNNLELERNRAQSEVRRLQTELYDMNQHNMTIQQELEASRTEAEDVKLQLQH 78
E++ + +L + +R+ A E RR Q +L + +Q+ELE SR E+ D+K QLQ
Sbjct: 40 EMENLQRQLQTVSYDRDNAIQENRRTQDDLAAVTSEVRNLQRELETSRGESFDLKRQLQT 99
Query: 79 YCCEVQRIEEILSKKESERLDLLKHLKFISQETAELENNNHSLDGEMKSCKNLLAESEKK 138
Y EV+R EE+L++KE+ER ++L H + +S E LENNNHSL+ E + L + +
Sbjct: 100 YVSEVRRAEELLNRKENERSEMLNHFRSLSLEATVLENNNHSLESEAAEARGALKSARDR 159
Query: 139 VMKLEALVQDKDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYRLGEELAGCQETLDTM 198
++ LE + DKD I+ E ++ EL+ A LETQ++ E+K+R +L ++ +
Sbjct: 160 LLDLERQLADKDSLIRGYETQISELTQNVASLETQLRQQGEQKHRAEADLTAVRDLCMKL 219
Query: 199 LRQKEELRLQLADTENYKTK 218
QK+ L QL D ++ KT+
Sbjct: 220 DEQKDTLMAQLDDKDSLKTQ 239
|
Source: Apis mellifera Species: Apis mellifera Genus: Apis Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|380017057|ref|XP_003692482.1| PREDICTED: centrosomal protein of 135 kDa-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328713843|ref|XP_001945549.2| PREDICTED: hypothetical protein LOC100163804 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|345484545|ref|XP_001605637.2| PREDICTED: centrosomal protein of 135 kDa-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|332026529|gb|EGI66649.1| Centrosomal protein of 135 kDa [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|350417848|ref|XP_003491609.1| PREDICTED: hypothetical protein LOC100747105 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307208304|gb|EFN85729.1| Centrosomal protein of 135 kDa [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|242005075|ref|XP_002423400.1| hypothetical protein Phum_PHUM055770 [Pediculus humanus corporis] gi|212506444|gb|EEB10662.1| hypothetical protein Phum_PHUM055770 [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|307167225|gb|EFN60929.1| Centrosomal protein of 135 kDa [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|357608405|gb|EHJ65983.1| putative centrosomal protein 135 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 224 | ||||||
| FB|FBgn0036480 | 1059 | Cep135 [Drosophila melanogaste | 0.959 | 0.203 | 0.269 | 3.1e-17 | |
| ZFIN|ZDB-GENE-041210-325 | 1170 | cep135 "centrosomal protein 13 | 0.888 | 0.170 | 0.277 | 1.2e-16 | |
| UNIPROTKB|Q66GS9 | 1140 | CEP135 "Centrosomal protein of | 0.937 | 0.184 | 0.271 | 2e-14 | |
| UNIPROTKB|F1ME99 | 1139 | CEP135 "Uncharacterized protei | 0.937 | 0.184 | 0.262 | 2.6e-14 | |
| UNIPROTKB|J9P569 | 919 | CEP135 "Uncharacterized protei | 0.937 | 0.228 | 0.262 | 1.1e-13 | |
| UNIPROTKB|F1PRN4 | 1137 | CEP135 "Uncharacterized protei | 0.937 | 0.184 | 0.262 | 1.4e-13 | |
| UNIPROTKB|I3LUU4 | 1107 | CEP135 "Uncharacterized protei | 0.919 | 0.186 | 0.263 | 2.3e-13 | |
| UNIPROTKB|E1BS91 | 1147 | CEP135 "Uncharacterized protei | 0.915 | 0.178 | 0.244 | 4.9e-13 | |
| UNIPROTKB|E1C7U7 | 1155 | CEP135 "Uncharacterized protei | 0.915 | 0.177 | 0.244 | 5e-13 | |
| RGD|1310726 | 1140 | Cep135 "centrosomal protein 13 | 0.848 | 0.166 | 0.27 | 1.3e-12 |
| FB|FBgn0036480 Cep135 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 224 (83.9 bits), Expect = 3.1e-17, P = 3.1e-17
Identities = 58/215 (26%), Positives = 108/215 (50%)
Query: 4 NLNKRSEREAKLATTEIDRFKYELNNLELERNRAQSEVRRLQTELYDMNQHNMTIQQELE 63
N N++ + E +TE + ++ L+ R+ A +E RRL +L D T+Q++L
Sbjct: 730 NRNRQRDSELTETSTESKTLRQQIVALKASRDEAIAENRRLMDKLSDAQVEARTLQKKLT 789
Query: 64 ASRTEAEDVKLQLQHYCCEVQRIEEILSKKESERLDLLKHLKFISQETAELENNNHSLDG 123
S + ++K QL Y EV++ E++L +KE ER D+L ++Q A LE NN SL+
Sbjct: 790 DSELQVANMKQQLHKYVQEVKKAEDLLIQKEKERDDMLDQYHCLTQGQATLEGNNQSLEC 849
Query: 124 EMKSCKNLLAESEKKVMKLEALVQDKDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYR 183
E + + E E +V L+ +Q + C++ +E +L LE +++ +++
Sbjct: 850 EAVEFRRQICELECEVHSLKEQLQLRQCALHDMEVQLTAARASVRCLERELENARDDIRV 909
Query: 184 LGEELAGCQETLDTMLRQKEELRLQLADTENYKTK 218
+L +E D + ++ +L +L D + K
Sbjct: 910 QKVDLEARKELCDKLDVERSKLNAELNDVNEIRKK 944
|
|
| ZFIN|ZDB-GENE-041210-325 cep135 "centrosomal protein 135" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q66GS9 CEP135 "Centrosomal protein of 135 kDa" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1ME99 CEP135 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P569 CEP135 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PRN4 CEP135 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LUU4 CEP135 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BS91 CEP135 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C7U7 CEP135 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1310726 Cep135 "centrosomal protein 135" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 224 | |||
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 7e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 9e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 0.003 |
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
Score = 53.5 bits (129), Expect = 2e-08
Identities = 51/228 (22%), Positives = 105/228 (46%), Gaps = 14/228 (6%)
Query: 6 NKRSEREAKLATTEIDRFKYELNNLELERNRAQSEVRRLQTEL--------------YDM 51
+ E E L ++ + EL L+ E A+ E+ L EL ++
Sbjct: 220 AELRELELALLVLRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSEL 279
Query: 52 NQHNMTIQQELEASRTEAEDVKLQLQHYCCEVQRIEEILSKKESERLDLLKHLKFISQET 111
+ +Q+EL A E ++ Q Q + +E L + E++ +L L +++E
Sbjct: 280 EEEIEELQKELYALANEISRLEQQKQILRERLANLERQLEELEAQLEELESKLDELAEEL 339
Query: 112 AELENNNHSLDGEMKSCKNLLAESEKKVMKLEALVQDKDCSIKSLEAKLEELSHVTAQLE 171
AELE L E++S + L E E ++ +LE+ +++ + +++L +K+ +L A L
Sbjct: 340 AELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQLELQIASLN 399
Query: 172 TQVQCCQEEKYRLGEELAGCQETLDTMLRQKEELRLQLADTENYKTKE 219
+++ + RL + Q+ ++ +L++ EE L+ E + +E
Sbjct: 400 NEIERLEARLERLEDRRERLQQEIEELLKKLEEAELKELQAELEELEE 447
|
SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1179 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 224 | |||
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.0 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.98 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.95 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.93 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.93 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.92 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.82 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.77 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.72 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.7 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.52 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.5 | |
| KOG0161|consensus | 1930 | 98.5 | ||
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.48 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.44 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.44 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.41 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.4 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.38 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 98.35 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.32 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 98.3 | |
| KOG0161|consensus | 1930 | 98.3 | ||
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.29 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.29 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 98.29 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 98.24 | |
| KOG0250|consensus | 1074 | 98.23 | ||
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.22 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 98.13 | |
| KOG0996|consensus | 1293 | 98.13 | ||
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 98.11 | |
| KOG0250|consensus | 1074 | 98.1 | ||
| KOG0996|consensus | 1293 | 98.04 | ||
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 98.02 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 98.02 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 97.99 | |
| KOG4674|consensus | 1822 | 97.93 | ||
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.91 | |
| KOG0964|consensus | 1200 | 97.9 | ||
| KOG0933|consensus | 1174 | 97.89 | ||
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 97.88 | |
| KOG0977|consensus | 546 | 97.82 | ||
| PRK01156 | 895 | chromosome segregation protein; Provisional | 97.79 | |
| KOG0933|consensus | 1174 | 97.79 | ||
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.74 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.74 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 97.73 | |
| KOG0964|consensus | 1200 | 97.72 | ||
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.69 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.68 | |
| KOG0977|consensus | 546 | 97.67 | ||
| PRK09039 | 343 | hypothetical protein; Validated | 97.61 | |
| KOG0976|consensus | 1265 | 97.6 | ||
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 97.58 | |
| KOG4674|consensus | 1822 | 97.58 | ||
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 97.55 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.51 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.48 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.46 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 97.46 | |
| KOG0980|consensus | 980 | 97.43 | ||
| KOG0971|consensus | 1243 | 97.41 | ||
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 97.4 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 97.39 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.3 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 97.28 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 97.26 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 97.24 | |
| KOG0018|consensus | 1141 | 97.2 | ||
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.13 | |
| KOG0971|consensus | 1243 | 97.08 | ||
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 97.06 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 97.06 | |
| KOG0612|consensus | 1317 | 97.05 | ||
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 97.05 | |
| KOG0946|consensus | 970 | 97.04 | ||
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 97.0 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 96.97 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.95 | |
| KOG0018|consensus | 1141 | 96.93 | ||
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.91 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 96.89 | |
| KOG1003|consensus | 205 | 96.87 | ||
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.86 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 96.85 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 96.84 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 96.62 | |
| KOG4643|consensus | 1195 | 96.62 | ||
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 96.61 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.57 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 96.55 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.52 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.51 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 96.4 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 96.4 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 96.34 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 96.31 | |
| KOG0978|consensus | 698 | 96.3 | ||
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 96.15 | |
| KOG0995|consensus | 581 | 96.03 | ||
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 96.02 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 95.99 | |
| KOG1029|consensus | 1118 | 95.92 | ||
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 95.88 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 95.87 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 95.84 | |
| KOG0978|consensus | 698 | 95.8 | ||
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 95.78 | |
| KOG0994|consensus | 1758 | 95.78 | ||
| KOG0963|consensus | 629 | 95.73 | ||
| KOG0612|consensus | 1317 | 95.72 | ||
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 95.63 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 95.62 | |
| KOG0995|consensus | 581 | 95.56 | ||
| KOG0963|consensus | 629 | 95.55 | ||
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 95.51 | |
| KOG0976|consensus | 1265 | 95.5 | ||
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 95.49 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 95.45 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 95.43 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 95.43 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 95.37 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 95.34 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 95.32 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 95.32 | |
| KOG0980|consensus | 980 | 95.26 | ||
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 95.24 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 95.2 | |
| KOG0243|consensus | 1041 | 95.07 | ||
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 95.05 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 95.0 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 94.99 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 94.91 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 94.88 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 94.77 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 94.74 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 94.74 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 94.72 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 94.58 | |
| PF13514 | 1111 | AAA_27: AAA domain | 94.56 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 94.56 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 94.5 | |
| KOG0994|consensus | 1758 | 94.5 | ||
| PRK11281 | 1113 | hypothetical protein; Provisional | 94.5 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 94.48 | |
| KOG0962|consensus | 1294 | 94.47 | ||
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 94.47 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 94.45 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 94.44 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 94.43 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 94.41 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 94.38 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 94.35 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 94.3 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 94.28 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 94.28 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 94.19 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 94.08 | |
| KOG0962|consensus | 1294 | 94.0 | ||
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 93.97 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 93.92 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 93.89 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 93.83 | |
| KOG0979|consensus | 1072 | 93.82 | ||
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 93.81 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 93.72 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 93.65 | |
| KOG0243|consensus | 1041 | 93.64 | ||
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 93.58 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 93.42 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 93.4 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 93.37 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 93.31 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 93.13 | |
| KOG0946|consensus | 970 | 93.08 | ||
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 92.96 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 92.96 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 92.91 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 92.91 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 92.73 | |
| KOG1029|consensus | 1118 | 92.72 | ||
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 92.56 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 92.54 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 92.26 | |
| PF08581 | 79 | Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t | 92.09 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 92.08 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 91.91 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 91.86 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 91.77 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 91.65 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 91.59 | |
| KOG0979|consensus | 1072 | 91.46 | ||
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 91.42 | |
| PF01920 | 106 | Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 | 91.37 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 91.22 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 91.17 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 91.15 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 91.12 | |
| PF13166 | 712 | AAA_13: AAA domain | 91.05 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 90.93 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 90.86 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 90.72 | |
| KOG4360|consensus | 596 | 90.61 | ||
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 90.59 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 90.49 | |
| KOG1937|consensus | 521 | 90.49 | ||
| KOG1003|consensus | 205 | 90.47 | ||
| KOG4673|consensus | 961 | 90.33 | ||
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 90.29 | |
| PF02994 | 370 | Transposase_22: L1 transposable element; InterPro: | 90.27 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 90.24 | |
| PF13747 | 89 | DUF4164: Domain of unknown function (DUF4164) | 90.17 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 89.87 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 89.83 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 89.5 | |
| KOG4643|consensus | 1195 | 89.44 | ||
| KOG1853|consensus | 333 | 89.39 | ||
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 89.13 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 88.89 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 88.68 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 88.63 | |
| KOG4673|consensus | 961 | 88.51 | ||
| PRK10698 | 222 | phage shock protein PspA; Provisional | 88.4 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 88.01 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 87.91 | |
| KOG4360|consensus | 596 | 87.78 | ||
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 87.55 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 87.51 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 87.36 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 86.98 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 86.87 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 86.73 | |
| PF10805 | 106 | DUF2730: Protein of unknown function (DUF2730); In | 86.29 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 86.25 | |
| KOG1899|consensus | 861 | 86.16 | ||
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 86.12 | |
| KOG1962|consensus | 216 | 86.12 | ||
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 85.98 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 85.92 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 85.92 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 85.9 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 85.88 | |
| KOG0249|consensus | 916 | 85.81 | ||
| KOG4302|consensus | 660 | 85.71 | ||
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 85.66 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 85.55 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 85.23 | |
| COG1730 | 145 | GIM5 Predicted prefoldin, molecular chaperone impl | 84.69 | |
| KOG4809|consensus | 654 | 84.57 | ||
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 84.52 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 84.33 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 83.9 | |
| PRK00736 | 68 | hypothetical protein; Provisional | 83.87 | |
| PRK02793 | 72 | phi X174 lysis protein; Provisional | 83.86 | |
| PRK00295 | 68 | hypothetical protein; Provisional | 83.85 | |
| KOG1853|consensus | 333 | 83.62 | ||
| KOG0999|consensus | 772 | 83.56 | ||
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 83.54 | |
| PF10805 | 106 | DUF2730: Protein of unknown function (DUF2730); In | 83.49 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 83.36 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 82.95 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 82.76 | |
| PF05377 | 55 | FlaC_arch: Flagella accessory protein C (FlaC); In | 82.68 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 82.52 | |
| KOG2991|consensus | 330 | 82.1 | ||
| KOG0247|consensus | 809 | 81.93 | ||
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 81.68 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 81.52 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 81.3 | |
| PF04859 | 131 | DUF641: Plant protein of unknown function (DUF641) | 81.23 | |
| KOG2991|consensus | 330 | 81.12 | ||
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 80.99 | |
| PF02994 | 370 | Transposase_22: L1 transposable element; InterPro: | 80.89 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 80.83 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 80.54 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 80.38 | |
| PRK01203 | 130 | prefoldin subunit alpha; Provisional | 80.29 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 80.18 |
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
Probab=99.00 E-value=9.5e-07 Score=90.68 Aligned_cols=58 Identities=19% Similarity=0.278 Sum_probs=22.5
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchH
Q psy5037 156 LEAKLEELSHVTAQLETQVQCCQEEKYRLGEELAGCQETLDTMLRQKEELRLQLADTE 213 (224)
Q Consensus 156 ~e~qL~~l~~~~~~lE~EL~~lk~er~~l~~dL~~~re~~~kld~~~e~l~~qL~~~~ 213 (224)
++..+..+...+..+..++..+..+...+...+..+......+....+.+...+..+.
T Consensus 873 ~~~~~~~l~~~l~~l~~~~~~l~~~~~~l~~~~~~l~~~~~~~~~~~~~l~~~~~~~~ 930 (1164)
T TIGR02169 873 LEAALRDLESRLGDLKKERDELEAQLRELERKIEELEAQIEKKRKRLSELKAKLEALE 930 (1164)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 3333333333333333333333333333333334444444444444444443333333
|
SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. |
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0018|consensus | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG0946|consensus | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0018|consensus | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >KOG1003|consensus | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG4643|consensus | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >KOG0963|consensus | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >KOG0963|consensus | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >KOG0962|consensus | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0962|consensus | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG0979|consensus | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG0946|consensus | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG0979|consensus | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG4360|consensus | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1937|consensus | Back alignment and domain information |
|---|
| >KOG1003|consensus | Back alignment and domain information |
|---|
| >KOG4673|consensus | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PF13747 DUF4164: Domain of unknown function (DUF4164) | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >KOG4643|consensus | Back alignment and domain information |
|---|
| >KOG1853|consensus | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >KOG4673|consensus | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG4360|consensus | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >KOG1899|consensus | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >KOG1962|consensus | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >KOG0249|consensus | Back alignment and domain information |
|---|
| >KOG4302|consensus | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4809|consensus | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PRK00736 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02793 phi X174 lysis protein; Provisional | Back alignment and domain information |
|---|
| >PRK00295 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1853|consensus | Back alignment and domain information |
|---|
| >KOG0999|consensus | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2991|consensus | Back alignment and domain information |
|---|
| >KOG0247|consensus | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF04859 DUF641: Plant protein of unknown function (DUF641); InterPro: IPR006943 This conserved region is found in a number of plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2991|consensus | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >PRK01203 prefoldin subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 224 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-16 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 6e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 8e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 7e-05 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Score = 77.2 bits (190), Expect = 1e-16
Identities = 37/206 (17%), Positives = 92/206 (44%)
Query: 6 NKRSEREAKLATTEIDRFKYELNNLELERNRAQSEVRRLQTELYDMNQHNMTIQQELEAS 65
K+ +++ +++ + L+LE+ A ++++++ ++ M N + +E +
Sbjct: 950 KKKMQQQMLDLEEQLEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLL 1009
Query: 66 RTEAEDVKLQLQHYCCEVQRIEEILSKKESERLDLLKHLKFISQETAELENNNHSLDGEM 125
D+ L + + + ++ +K ES +L LK + ELE L+GE
Sbjct: 1010 EERVSDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGES 1069
Query: 126 KSCKNLLAESEKKVMKLEALVQDKDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYRLG 185
+AE + ++ +L+A + K+ +++ A+LE+ + +++ + L
Sbjct: 1070 SDLHEQIAELQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQ 1129
Query: 186 EELAGCQETLDTMLRQKEELRLQLAD 211
E+L + + +QK +L +L
Sbjct: 1130 EDLESEKAARNKAEKQKRDLSEELEA 1155
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 224 | |||
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 99.26 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 99.24 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.63 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.59 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 98.45 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 98.36 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 97.82 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.6 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.59 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 97.57 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 97.14 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 96.87 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 96.87 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 96.86 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.81 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.79 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.79 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 96.78 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 96.76 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 96.74 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 96.66 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 96.65 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 96.45 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 96.36 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 96.32 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.98 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 95.79 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 95.75 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 95.53 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 95.32 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 95.23 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 95.21 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 95.01 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 94.88 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 94.82 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 94.76 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 94.72 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 94.67 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 94.65 | |
| 1x8y_A | 86 | Lamin A/C; structural protein, intermediate filame | 94.62 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 94.47 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 94.35 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 94.14 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 94.07 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 94.07 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 93.91 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 93.72 | |
| 2no2_A | 107 | HIP-I, huntingtin-interacting protein 1; clathrin | 93.69 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 93.22 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 93.04 | |
| 1fxk_A | 107 | Prefoldin; archaeal protein, chaperone; 2.30A {Met | 92.87 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 92.8 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 92.63 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 92.07 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 91.98 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 91.93 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 91.29 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 91.24 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 90.28 | |
| 3mov_A | 95 | Lamin-B1; LMNB1, B-type lamins, intermediate filam | 90.13 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 89.29 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 88.75 | |
| 2xzr_A | 114 | Immunoglobulin-binding protein EIBD; cell adhesion | 88.54 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 88.31 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 87.94 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 87.94 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 87.7 | |
| 4h22_A | 103 | Leucine-rich repeat flightless-interacting protei; | 87.58 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 86.75 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 86.63 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 86.4 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 86.37 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 84.44 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 84.2 | |
| 1fxk_C | 133 | Protein (prefoldin); archaeal protein, chaperone; | 83.51 | |
| 1x8y_A | 86 | Lamin A/C; structural protein, intermediate filame | 82.89 | |
| 2xnx_M | 146 | M protein, M1-BC1; cell adhesion, virulence factor | 82.75 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 81.97 | |
| 2oto_A | 155 | M protein; helical coiled coil, fibrinogen-binding | 81.86 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 81.66 | |
| 4emc_A | 190 | Monopolin complex subunit CSM1; RWD domain, kineto | 81.66 | |
| 3trt_A | 77 | Vimentin; cytoskeleton, intermediate filament, alp | 81.49 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 80.75 | |
| 2lw1_A | 89 | ABC transporter ATP-binding protein UUP; ABC REG s | 80.45 |
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
Probab=99.26 E-value=5.4e-08 Score=80.95 Aligned_cols=68 Identities=15% Similarity=0.168 Sum_probs=30.8
Q ss_pred HHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchHHHH
Q psy5037 149 KDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYRLGEELAGCQETLDTMLRQKEELRLQLADTENYK 216 (224)
Q Consensus 149 ~~~~i~~~e~qL~~l~~~~~~lE~EL~~lk~er~~l~~dL~~~re~~~kld~~~e~l~~qL~~~~~~~ 216 (224)
....+..+...+..+...+..++..+..+......+...+..+...+..+......+...+..+....
T Consensus 200 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 267 (284)
T 1c1g_A 200 VTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKY 267 (284)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 33333333444444444444444444444444444444444444444444444444444444443333
|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd} | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >1fxk_C Protein (prefoldin); archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 | Back alignment and structure |
|---|
| >1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A | Back alignment and structure |
|---|
| >2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A | Back alignment and structure |
|---|
| >3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 224 | |||
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 93.3 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 89.47 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 85.37 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 82.79 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 81.25 |
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Prefoldin family: Prefoldin domain: Prefoldin beta subunit species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
Probab=93.30 E-value=0.46 Score=33.39 Aligned_cols=75 Identities=11% Similarity=0.246 Sum_probs=37.8
Q ss_pred HHHHHHHHHHHHHHHHhhhhhhhhhhhhhhhhHhH----------------------HHHHHHHHHHHHHhHHhhHHHHH
Q psy5037 100 LLKHLKFISQETAELENNNHSLDGEMKSCKNLLAE----------------------SEKKVMKLEALVQDKDCSIKSLE 157 (224)
Q Consensus 100 Lle~~~~l~~e~~~lE~r~~~lE~e~nel~le~~~----------------------~~~ri~~le~~I~e~~~~i~~~e 157 (224)
...+|..+..++..+-..+..+++.+++..+-+.. ..+=+..+..++......|..++
T Consensus 6 ~~~~~q~lq~el~~~~~q~~~le~q~~E~~~vl~eL~~l~~d~~vyk~vG~vLv~~~~~e~~~~l~~~~e~l~~~i~~l~ 85 (107)
T d1fxka_ 6 QLAQFQQLQQQAQAISVQKQTVEMQINETQKALEELSRAADDAEVYKSSGNILIRVAKDELTEELQEKLETLQLREKTIE 85 (107)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTCCEEEEETTEEEEECHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCcccHHHHHhcchhhcCcHHHHHHHHHHHHHHHHHHHHHHH
Confidence 44555555555555555555555555555444422 23334444445555555555555
Q ss_pred HHHHHHHHHHHHHHHHH
Q psy5037 158 AKLEELSHVTAQLETQV 174 (224)
Q Consensus 158 ~qL~~l~~~~~~lE~EL 174 (224)
.++..+...+.++...+
T Consensus 86 ~q~~~l~~~l~~~~~~l 102 (107)
T d1fxka_ 86 RQEERVMKKLQEMQVNI 102 (107)
T ss_dssp HHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHH
Confidence 55555555544444444
|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|