Psyllid ID: psy5037


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
ETLNLNKRSEREAKLATTEIDRFKYELNNLELERNRAQSEVRRLQTELYDMNQHNMTIQQELEASRTEAEDVKLQLQHYCCEVQRIEEILSKKESERLDLLKHLKFISQETAELENNNHSLDGEMKSCKNLLAESEKKVMKLEALVQDKDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYRLGEELAGCQETLDTMLRQKEELRLQLADTENYKTKESAPMA
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
ccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
ETLNLNKRSEREAKLATTEIDRFKYELNNLELERNRAQSEVRRLQTELYDMNQHNMTIQQELEASRTEAEDVKLQLQHYCCEVQRIEEILSKKESERLDLLKHLKFISQETAElennnhsldGEMKSCKNLLAESEKKVMKLEALVQDKDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYRLGEELAGCQETLDTMLRQKEELRLQLAdtenyktkesapma
etlnlnkrsereaklatteidrfkyelnnlelernraQSEVRRLQTELYDMNQHNMTIQQELEASRTEAEDVKLQLQHYCCEVQRIEEILSKKESERLDLLKHLKFISQETaelennnhsldGEMKSCKNLLAESEKKVMKLEALVQDKDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYRLGEELAGCQETLDTMLRQKEELRlqladtenyktkesapma
ETLNLNKRSEREAKLATTEIDRFKYELNNLELERNRAQSEVRRLQTELYDMNQHNMTIQQELEASRTEAEDVKLQLQHYCCEVQRIEEILSKKESERLDLLKHLKFISQETAELENNNHSLDGEMKSCKNLLAESEKKVMKLEALVQDKDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYRLGEELAGCQETLDTMLRQKEELRLQLADTENYKTKESAPMA
**********************FKYEL********************************************VKLQLQHYCCEVQRIEEILSK****RLDLLKHLKFI**********************************LEALVQDKDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYRLGEELAGCQETLD****************************
********************************************************************************************************************************************************************************************************************************
*************KLATTEIDRFKYELNNLELERNRAQSEVRRLQTELYDMNQHNMTIQQELEASRTEAEDVKLQLQHYCCEVQRIEEILSKKESERLDLLKHLKFISQETAELENNNHSLDGEMKSCKNLLAESEKKVMKLEALVQDKDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYRLGEELAGCQETLDTMLRQKEELRLQLADTENY*********
*****NKRSEREAKLATTEIDRFKYELNNLELERNRAQSEVRRLQTELYDMNQHNMTIQQELEASRTEAEDVKLQLQHYCCEVQRIEEILSKKESERLDLLKHLKFISQETAELENNNHSLDGEMKSCKNLLAESEKKVMKLEALVQDKDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYRLGEELAGCQETLDTMLRQKEELRLQLADTE***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ETLNLNKRSERExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLQHYCCEVQRIEEILSKKESERLDLLKHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVQDKDCSxxxxxxxxxxxxxxxxxxxxxxxxxxxxKYRLGEExxxxxxxxxxxxxxxxxxxxxxxxxxxxKTKESAPMA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query224 2.2.26 [Sep-21-2011]
Q5RG45 1164 Centrosomal protein of 13 yes N/A 0.825 0.158 0.273 4e-10
Q66GS9 1140 Centrosomal protein of 13 yes N/A 0.821 0.161 0.272 3e-07
Q6P5D4 1140 Centrosomal protein of 13 yes N/A 0.821 0.161 0.261 6e-06
>sp|Q5RG45|CP135_DANRE Centrosomal protein of 135 kDa OS=Danio rerio GN=cep135 PE=2 SV=2 Back     alignment and function desciption
 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 108/194 (55%), Gaps = 9/194 (4%)

Query: 9   SEREAKLAT--TEIDRFKYELNNLELERNRAQSEVRRLQTELYDMNQHNMTIQQELEASR 66
           S RE ++A+   ++D+ + EL ++  +R  A  E RRLQ +L  M + N  +  E++ + 
Sbjct: 791 SSREREIASLRRQLDQSQEELFSVSRDREVALRENRRLQDDLATMTRENQAVHAEMQEAL 850

Query: 67  TEAEDVKLQLQHYCCEVQRIEEILSKKESERLDLLKHLKFISQETAELENNNHSLDGEMK 126
            E +++KL++  Y  EV RIE +++ KE E  D+L+  + I  E+ + E      +G   
Sbjct: 851 NERDELKLRVHSYISEVARIESLMAAKEQENRDMLERFRSIHTESEDKELKLQQSEGLNN 910

Query: 127 SCK--NLLAESEKKVMKLEALVQDKDC-----SIKSLEAKLEELSHVTAQLETQVQCCQE 179
           S +   L +++E++ ++    +QD++      ++++ EA++  L+   ++LE +VQ  + 
Sbjct: 911 SIRLELLSSDTERRHLRERVSLQDREIQEHLNALQAYEAQVSSLARAMSRLEEEVQAARA 970

Query: 180 EKYRLGEELAGCQE 193
           EK  +  +LA  +E
Sbjct: 971 EKASVLADLASVRE 984




Centrosomal protein involved in centriole biogenesis. Acts as a scaffolding protein during early centriole biogenesis. Also required for centriole-centriole cohesion during interphase by acting as a platform protein for cep250 at the centriole.
Danio rerio (taxid: 7955)
>sp|Q66GS9|CP135_HUMAN Centrosomal protein of 135 kDa OS=Homo sapiens GN=CEP135 PE=1 SV=2 Back     alignment and function description
>sp|Q6P5D4|CP135_MOUSE Centrosomal protein of 135 kDa OS=Mus musculus GN=Cep135 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query224
328791605 397 PREDICTED: centrosomal protein of 135 kD 0.892 0.503 0.36 2e-23
380017057 676 PREDICTED: centrosomal protein of 135 kD 0.919 0.304 0.354 6e-23
328713843 1032 PREDICTED: hypothetical protein LOC10016 0.883 0.191 0.380 1e-22
345484545 868 PREDICTED: centrosomal protein of 135 kD 0.933 0.240 0.349 1e-22
332026529 393 Centrosomal protein of 135 kDa [Acromyrm 0.825 0.470 0.372 2e-22
350417848 1119 PREDICTED: hypothetical protein LOC10074 0.933 0.186 0.334 8e-21
307208304 446 Centrosomal protein of 135 kDa [Harpegna 0.857 0.430 0.354 1e-20
242005075 1136 hypothetical protein Phum_PHUM055770 [Pe 0.848 0.167 0.368 2e-19
307167225 388 Centrosomal protein of 135 kDa [Camponot 0.825 0.476 0.356 8e-17
357608405297 putative centrosomal protein 135 [Danaus 0.633 0.478 0.394 8e-15
>gi|328791605|ref|XP_003251598.1| PREDICTED: centrosomal protein of 135 kDa-like [Apis mellifera] Back     alignment and taxonomy information
 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 117/200 (58%)

Query: 19  EIDRFKYELNNLELERNRAQSEVRRLQTELYDMNQHNMTIQQELEASRTEAEDVKLQLQH 78
           E++  + +L  +  +R+ A  E RR Q +L  +      +Q+ELE SR E+ D+K QLQ 
Sbjct: 40  EMENLQRQLQTVSYDRDNAIQENRRTQDDLAAVTSEVRNLQRELETSRGESFDLKRQLQT 99

Query: 79  YCCEVQRIEEILSKKESERLDLLKHLKFISQETAELENNNHSLDGEMKSCKNLLAESEKK 138
           Y  EV+R EE+L++KE+ER ++L H + +S E   LENNNHSL+ E    +  L  +  +
Sbjct: 100 YVSEVRRAEELLNRKENERSEMLNHFRSLSLEATVLENNNHSLESEAAEARGALKSARDR 159

Query: 139 VMKLEALVQDKDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYRLGEELAGCQETLDTM 198
           ++ LE  + DKD  I+  E ++ EL+   A LETQ++   E+K+R   +L   ++    +
Sbjct: 160 LLDLERQLADKDSLIRGYETQISELTQNVASLETQLRQQGEQKHRAEADLTAVRDLCMKL 219

Query: 199 LRQKEELRLQLADTENYKTK 218
             QK+ L  QL D ++ KT+
Sbjct: 220 DEQKDTLMAQLDDKDSLKTQ 239




Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380017057|ref|XP_003692482.1| PREDICTED: centrosomal protein of 135 kDa-like [Apis florea] Back     alignment and taxonomy information
>gi|328713843|ref|XP_001945549.2| PREDICTED: hypothetical protein LOC100163804 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|345484545|ref|XP_001605637.2| PREDICTED: centrosomal protein of 135 kDa-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332026529|gb|EGI66649.1| Centrosomal protein of 135 kDa [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350417848|ref|XP_003491609.1| PREDICTED: hypothetical protein LOC100747105 [Bombus impatiens] Back     alignment and taxonomy information
>gi|307208304|gb|EFN85729.1| Centrosomal protein of 135 kDa [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242005075|ref|XP_002423400.1| hypothetical protein Phum_PHUM055770 [Pediculus humanus corporis] gi|212506444|gb|EEB10662.1| hypothetical protein Phum_PHUM055770 [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307167225|gb|EFN60929.1| Centrosomal protein of 135 kDa [Camponotus floridanus] Back     alignment and taxonomy information
>gi|357608405|gb|EHJ65983.1| putative centrosomal protein 135 [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query224
FB|FBgn0036480 1059 Cep135 [Drosophila melanogaste 0.959 0.203 0.269 3.1e-17
ZFIN|ZDB-GENE-041210-325 1170 cep135 "centrosomal protein 13 0.888 0.170 0.277 1.2e-16
UNIPROTKB|Q66GS9 1140 CEP135 "Centrosomal protein of 0.937 0.184 0.271 2e-14
UNIPROTKB|F1ME99 1139 CEP135 "Uncharacterized protei 0.937 0.184 0.262 2.6e-14
UNIPROTKB|J9P569 919 CEP135 "Uncharacterized protei 0.937 0.228 0.262 1.1e-13
UNIPROTKB|F1PRN4 1137 CEP135 "Uncharacterized protei 0.937 0.184 0.262 1.4e-13
UNIPROTKB|I3LUU41107 CEP135 "Uncharacterized protei 0.919 0.186 0.263 2.3e-13
UNIPROTKB|E1BS91 1147 CEP135 "Uncharacterized protei 0.915 0.178 0.244 4.9e-13
UNIPROTKB|E1C7U7 1155 CEP135 "Uncharacterized protei 0.915 0.177 0.244 5e-13
RGD|1310726 1140 Cep135 "centrosomal protein 13 0.848 0.166 0.27 1.3e-12
FB|FBgn0036480 Cep135 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 224 (83.9 bits), Expect = 3.1e-17, P = 3.1e-17
 Identities = 58/215 (26%), Positives = 108/215 (50%)

Query:     4 NLNKRSEREAKLATTEIDRFKYELNNLELERNRAQSEVRRLQTELYDMNQHNMTIQQELE 63
             N N++ + E    +TE    + ++  L+  R+ A +E RRL  +L D      T+Q++L 
Sbjct:   730 NRNRQRDSELTETSTESKTLRQQIVALKASRDEAIAENRRLMDKLSDAQVEARTLQKKLT 789

Query:    64 ASRTEAEDVKLQLQHYCCEVQRIEEILSKKESERLDLLKHLKFISQETAELENNNHSLDG 123
              S  +  ++K QL  Y  EV++ E++L +KE ER D+L     ++Q  A LE NN SL+ 
Sbjct:   790 DSELQVANMKQQLHKYVQEVKKAEDLLIQKEKERDDMLDQYHCLTQGQATLEGNNQSLEC 849

Query:   124 EMKSCKNLLAESEKKVMKLEALVQDKDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYR 183
             E    +  + E E +V  L+  +Q + C++  +E +L         LE +++  +++   
Sbjct:   850 EAVEFRRQICELECEVHSLKEQLQLRQCALHDMEVQLTAARASVRCLERELENARDDIRV 909

Query:   184 LGEELAGCQETLDTMLRQKEELRLQLADTENYKTK 218
                +L   +E  D +  ++ +L  +L D    + K
Sbjct:   910 QKVDLEARKELCDKLDVERSKLNAELNDVNEIRKK 944


GO:0007099 "centriole replication" evidence=IMP
GO:0005814 "centriole" evidence=IDA
GO:0005932 "microtubule basal body" evidence=IDA
GO:0007288 "sperm axoneme assembly" evidence=IMP
GO:0032053 "microtubule basal body organization" evidence=IMP
GO:0005813 "centrosome" evidence=IDA
GO:0051297 "centrosome organization" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
GO:0007026 "negative regulation of microtubule depolymerization" evidence=IMP
GO:0008017 "microtubule binding" evidence=IDA
ZFIN|ZDB-GENE-041210-325 cep135 "centrosomal protein 135" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q66GS9 CEP135 "Centrosomal protein of 135 kDa" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1ME99 CEP135 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P569 CEP135 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PRN4 CEP135 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LUU4 CEP135 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BS91 CEP135 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7U7 CEP135 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1310726 Cep135 "centrosomal protein 135" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-08
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-06
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 7e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 9e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
COG4372 499 COG4372, COG4372, Uncharacterized protein conserve 0.003
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
 Score = 53.5 bits (129), Expect = 2e-08
 Identities = 51/228 (22%), Positives = 105/228 (46%), Gaps = 14/228 (6%)

Query: 6   NKRSEREAKLATTEIDRFKYELNNLELERNRAQSEVRRLQTEL--------------YDM 51
            +  E E  L    ++  + EL  L+ E   A+ E+  L  EL               ++
Sbjct: 220 AELRELELALLVLRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSEL 279

Query: 52  NQHNMTIQQELEASRTEAEDVKLQLQHYCCEVQRIEEILSKKESERLDLLKHLKFISQET 111
            +    +Q+EL A   E   ++ Q Q     +  +E  L + E++  +L   L  +++E 
Sbjct: 280 EEEIEELQKELYALANEISRLEQQKQILRERLANLERQLEELEAQLEELESKLDELAEEL 339

Query: 112 AELENNNHSLDGEMKSCKNLLAESEKKVMKLEALVQDKDCSIKSLEAKLEELSHVTAQLE 171
           AELE     L  E++S +  L E E ++ +LE+ +++ +  +++L +K+ +L    A L 
Sbjct: 340 AELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQLELQIASLN 399

Query: 172 TQVQCCQEEKYRLGEELAGCQETLDTMLRQKEELRLQLADTENYKTKE 219
            +++  +    RL +     Q+ ++ +L++ EE  L+    E  + +E
Sbjct: 400 NEIERLEARLERLEDRRERLQQEIEELLKKLEEAELKELQAELEELEE 447


SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1179

>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 224
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 99.0
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 98.98
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 98.95
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 98.93
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 98.93
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 98.92
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 98.82
PF00038312 Filament: Intermediate filament protein; InterPro: 98.77
PRK02224 880 chromosome segregation protein; Provisional 98.72
PRK02224 880 chromosome segregation protein; Provisional 98.7
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 98.52
PHA02562 562 46 endonuclease subunit; Provisional 98.5
KOG0161|consensus 1930 98.5
PF00038312 Filament: Intermediate filament protein; InterPro: 98.48
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 98.44
PRK11637 428 AmiB activator; Provisional 98.44
PHA02562 562 46 endonuclease subunit; Provisional 98.41
PRK11637 428 AmiB activator; Provisional 98.4
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 98.38
PF05701 522 WEMBL: Weak chloroplast movement under blue light; 98.35
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 98.32
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 98.3
KOG0161|consensus 1930 98.3
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 98.29
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 98.29
PF14662193 CCDC155: Coiled-coil region of CCDC155 98.29
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 98.24
KOG0250|consensus 1074 98.23
PRK03918 880 chromosome segregation protein; Provisional 98.22
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 98.13
KOG0996|consensus 1293 98.13
PF05701 522 WEMBL: Weak chloroplast movement under blue light; 98.11
KOG0250|consensus 1074 98.1
KOG0996|consensus 1293 98.04
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 98.02
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 98.02
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 97.99
KOG4674|consensus 1822 97.93
PRK04778569 septation ring formation regulator EzrA; Provision 97.91
KOG0964|consensus 1200 97.9
KOG0933|consensus 1174 97.89
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 97.88
KOG0977|consensus 546 97.82
PRK01156 895 chromosome segregation protein; Provisional 97.79
KOG0933|consensus 1174 97.79
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 97.74
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.74
PRK01156 895 chromosome segregation protein; Provisional 97.73
KOG0964|consensus 1200 97.72
PRK04863 1486 mukB cell division protein MukB; Provisional 97.69
PRK09039 343 hypothetical protein; Validated 97.68
KOG0977|consensus 546 97.67
PRK09039343 hypothetical protein; Validated 97.61
KOG0976|consensus 1265 97.6
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 97.58
KOG4674|consensus 1822 97.58
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 97.55
PRK04863 1486 mukB cell division protein MukB; Provisional 97.51
PRK04778569 septation ring formation regulator EzrA; Provision 97.48
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 97.46
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 97.46
KOG0980|consensus 980 97.43
KOG0971|consensus 1243 97.41
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 97.4
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 97.39
PF14662193 CCDC155: Coiled-coil region of CCDC155 97.3
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 97.28
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 97.26
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 97.24
KOG0018|consensus 1141 97.2
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 97.13
KOG0971|consensus 1243 97.08
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 97.06
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 97.06
KOG0612|consensus 1317 97.05
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 97.05
KOG0946|consensus970 97.04
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 97.0
COG4942 420 Membrane-bound metallopeptidase [Cell division and 96.97
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 96.95
KOG0018|consensus 1141 96.93
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 96.91
PF05911769 DUF869: Plant protein of unknown function (DUF869) 96.89
KOG1003|consensus205 96.87
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.86
COG3883265 Uncharacterized protein conserved in bacteria [Fun 96.85
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 96.84
PF13851201 GAS: Growth-arrest specific micro-tubule binding 96.62
KOG4643|consensus 1195 96.62
PF06160 560 EzrA: Septation ring formation regulator, EzrA ; I 96.61
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 96.57
COG4942 420 Membrane-bound metallopeptidase [Cell division and 96.55
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 96.52
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 96.51
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 96.4
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 96.4
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 96.34
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 96.31
KOG0978|consensus698 96.3
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 96.15
KOG0995|consensus 581 96.03
PF13870177 DUF4201: Domain of unknown function (DUF4201) 96.02
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 95.99
KOG1029|consensus 1118 95.92
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 95.88
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 95.87
PF13851201 GAS: Growth-arrest specific micro-tubule binding 95.84
KOG0978|consensus698 95.8
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 95.78
KOG0994|consensus1758 95.78
KOG0963|consensus 629 95.73
KOG0612|consensus 1317 95.72
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 95.63
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 95.62
KOG0995|consensus581 95.56
KOG0963|consensus 629 95.55
TIGR03007 498 pepcterm_ChnLen polysaccharide chain length determ 95.51
KOG0976|consensus 1265 95.5
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 95.49
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 95.45
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 95.43
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 95.43
COG5185 622 HEC1 Protein involved in chromosome segregation, i 95.37
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 95.34
TIGR02977219 phageshock_pspA phage shock protein A. Members of 95.32
PF04582326 Reo_sigmaC: Reovirus sigma C capsid protein; Inter 95.32
KOG0980|consensus 980 95.26
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 95.24
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 95.2
KOG0243|consensus 1041 95.07
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 95.05
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 95.0
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 94.99
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 94.91
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 94.88
PF05483 786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 94.77
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 94.74
COG4026290 Uncharacterized protein containing TOPRIM domain, 94.74
COG3883265 Uncharacterized protein conserved in bacteria [Fun 94.72
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 94.58
PF13514 1111 AAA_27: AAA domain 94.56
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 94.56
PRK10246 1047 exonuclease subunit SbcC; Provisional 94.5
KOG0994|consensus1758 94.5
PRK11281 1113 hypothetical protein; Provisional 94.5
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 94.48
KOG0962|consensus 1294 94.47
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 94.47
PF10186302 Atg14: UV radiation resistance protein and autopha 94.45
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 94.44
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 94.43
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 94.41
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 94.38
PRK11281 1113 hypothetical protein; Provisional 94.35
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 94.3
PF04582 326 Reo_sigmaC: Reovirus sigma C capsid protein; Inter 94.28
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 94.28
COG4372 499 Uncharacterized protein conserved in bacteria with 94.19
COG4372 499 Uncharacterized protein conserved in bacteria with 94.08
KOG0962|consensus 1294 94.0
PF09789 319 DUF2353: Uncharacterized coiled-coil protein (DUF2 93.97
cd00632105 Prefoldin_beta Prefoldin beta; Prefoldin is a hexa 93.92
PF10481 307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 93.89
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 93.83
KOG0979|consensus 1072 93.82
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 93.81
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 93.72
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 93.65
KOG0243|consensus 1041 93.64
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 93.58
PRK1542279 septal ring assembly protein ZapB; Provisional 93.42
PF05384159 DegS: Sensor protein DegS; InterPro: IPR008595 Thi 93.4
PF10186 302 Atg14: UV radiation resistance protein and autopha 93.37
COG2433652 Uncharacterized conserved protein [Function unknow 93.31
PRK09343121 prefoldin subunit beta; Provisional 93.13
KOG0946|consensus970 93.08
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 92.96
COG2433652 Uncharacterized conserved protein [Function unknow 92.96
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 92.91
PRK10698222 phage shock protein PspA; Provisional 92.91
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 92.73
KOG1029|consensus 1118 92.72
PF12795240 MscS_porin: Mechanosensitive ion channel porin dom 92.56
PF13870177 DUF4201: Domain of unknown function (DUF4201) 92.54
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 92.26
PF0858179 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t 92.09
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 92.08
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 91.91
COG4026290 Uncharacterized protein containing TOPRIM domain, 91.86
COG1382119 GimC Prefoldin, chaperonin cofactor [Posttranslati 91.77
PF09738 302 DUF2051: Double stranded RNA binding protein (DUF2 91.65
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 91.59
KOG0979|consensus 1072 91.46
TIGR03007 498 pepcterm_ChnLen polysaccharide chain length determ 91.42
PF01920106 Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 91.37
TIGR00634 563 recN DNA repair protein RecN. All proteins in this 91.22
PF09755 310 DUF2046: Uncharacterized conserved protein H4 (DUF 91.17
PF07111 739 HCR: Alpha helical coiled-coil rod protein (HCR); 91.15
PF07889126 DUF1664: Protein of unknown function (DUF1664); In 91.12
PF13166 712 AAA_13: AAA domain 91.05
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 90.93
COG4477 570 EzrA Negative regulator of septation ring formatio 90.86
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 90.72
KOG4360|consensus 596 90.61
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 90.59
PRK10884206 SH3 domain-containing protein; Provisional 90.49
KOG1937|consensus521 90.49
KOG1003|consensus205 90.47
KOG4673|consensus 961 90.33
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 90.29
PF02994370 Transposase_22: L1 transposable element; InterPro: 90.27
TIGR02977219 phageshock_pspA phage shock protein A. Members of 90.24
PF1374789 DUF4164: Domain of unknown function (DUF4164) 90.17
PRK03947140 prefoldin subunit alpha; Reviewed 89.87
PRK10884206 SH3 domain-containing protein; Provisional 89.83
PF09787 511 Golgin_A5: Golgin subfamily A member 5; InterPro: 89.5
KOG4643|consensus 1195 89.44
KOG1853|consensus 333 89.39
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 89.13
PRK10246 1047 exonuclease subunit SbcC; Provisional 88.89
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 88.68
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 88.63
KOG4673|consensus 961 88.51
PRK10698222 phage shock protein PspA; Provisional 88.4
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 88.01
PF10481 307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 87.91
KOG4360|consensus 596 87.78
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 87.55
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 87.51
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 87.36
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 86.98
PF07111 739 HCR: Alpha helical coiled-coil rod protein (HCR); 86.87
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 86.73
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 86.29
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 86.25
KOG1899|consensus 861 86.16
PF09738 302 DUF2051: Double stranded RNA binding protein (DUF2 86.12
KOG1962|consensus216 86.12
PRK10929 1109 putative mechanosensitive channel protein; Provisi 85.98
PF15290 305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 85.92
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 85.92
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 85.9
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 85.88
KOG0249|consensus 916 85.81
KOG4302|consensus 660 85.71
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 85.66
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 85.55
PF15294278 Leu_zip: Leucine zipper 85.23
COG1730145 GIM5 Predicted prefoldin, molecular chaperone impl 84.69
KOG4809|consensus 654 84.57
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 84.52
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 84.33
PRK1542279 septal ring assembly protein ZapB; Provisional 83.9
PRK0073668 hypothetical protein; Provisional 83.87
PRK0279372 phi X174 lysis protein; Provisional 83.86
PRK0029568 hypothetical protein; Provisional 83.85
KOG1853|consensus 333 83.62
KOG0999|consensus 772 83.56
PF05010207 TACC: Transforming acidic coiled-coil-containing p 83.54
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 83.49
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 83.36
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 82.95
TIGR02231 525 conserved hypothetical protein. This family consis 82.76
PF0537755 FlaC_arch: Flagella accessory protein C (FlaC); In 82.68
PRK0211973 hypothetical protein; Provisional 82.52
KOG2991|consensus330 82.1
KOG0247|consensus 809 81.93
COG307479 Uncharacterized protein conserved in bacteria [Fun 81.68
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 81.52
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 81.3
PF04859131 DUF641: Plant protein of unknown function (DUF641) 81.23
KOG2991|consensus330 81.12
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 80.99
PF02994 370 Transposase_22: L1 transposable element; InterPro: 80.89
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 80.83
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 80.54
cd00632105 Prefoldin_beta Prefoldin beta; Prefoldin is a hexa 80.38
PRK01203130 prefoldin subunit alpha; Provisional 80.29
PRK0440675 hypothetical protein; Provisional 80.18
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
Probab=99.00  E-value=9.5e-07  Score=90.68  Aligned_cols=58  Identities=19%  Similarity=0.278  Sum_probs=22.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchH
Q psy5037         156 LEAKLEELSHVTAQLETQVQCCQEEKYRLGEELAGCQETLDTMLRQKEELRLQLADTE  213 (224)
Q Consensus       156 ~e~qL~~l~~~~~~lE~EL~~lk~er~~l~~dL~~~re~~~kld~~~e~l~~qL~~~~  213 (224)
                      ++..+..+...+..+..++..+..+...+...+..+......+....+.+...+..+.
T Consensus       873 ~~~~~~~l~~~l~~l~~~~~~l~~~~~~l~~~~~~l~~~~~~~~~~~~~l~~~~~~~~  930 (1164)
T TIGR02169       873 LEAALRDLESRLGDLKKERDELEAQLRELERKIEELEAQIEKKRKRLSELKAKLEALE  930 (1164)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3333333333333333333333333333333334444444444444444443333333



SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent.

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>KOG4674|consensus Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG0964|consensus Back     alignment and domain information
>KOG0933|consensus Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0977|consensus Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0933|consensus Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0964|consensus Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG0977|consensus Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG0976|consensus Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG4674|consensus Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG0980|consensus Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG0018|consensus Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG0018|consensus Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>KOG1003|consensus Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>KOG4643|consensus Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>KOG0995|consensus Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG0963|consensus Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>KOG0995|consensus Back     alignment and domain information
>KOG0963|consensus Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0976|consensus Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer Back     alignment and domain information
>KOG0980|consensus Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>KOG0962|consensus Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>KOG0962|consensus Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>KOG0979|consensus Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09343 prefoldin subunit beta; Provisional Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PF12795 MscS_porin: Mechanosensitive ion channel porin domain Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>KOG0979|consensus Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG4360|consensus Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG1937|consensus Back     alignment and domain information
>KOG1003|consensus Back     alignment and domain information
>KOG4673|consensus Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PRK03947 prefoldin subunit alpha; Reviewed Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>KOG4643|consensus Back     alignment and domain information
>KOG1853|consensus Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG4673|consensus Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>KOG4360|consensus Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>KOG1899|consensus Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>KOG1962|consensus Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>KOG0249|consensus Back     alignment and domain information
>KOG4302|consensus Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4809|consensus Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>KOG1853|consensus Back     alignment and domain information
>KOG0999|consensus Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>KOG2991|consensus Back     alignment and domain information
>KOG0247|consensus Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF04859 DUF641: Plant protein of unknown function (DUF641); InterPro: IPR006943 This conserved region is found in a number of plant proteins of unknown function Back     alignment and domain information
>KOG2991|consensus Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea Back     alignment and domain information
>PRK01203 prefoldin subunit alpha; Provisional Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-16
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-11
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-11
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 1e-10
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-09
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 6e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 7e-05
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
 Score = 77.2 bits (190), Expect = 1e-16
 Identities = 37/206 (17%), Positives = 92/206 (44%)

Query: 6    NKRSEREAKLATTEIDRFKYELNNLELERNRAQSEVRRLQTELYDMNQHNMTIQQELEAS 65
             K+ +++      +++  +     L+LE+  A  ++++++ ++  M   N  + +E +  
Sbjct: 950  KKKMQQQMLDLEEQLEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLL 1009

Query: 66   RTEAEDVKLQLQHYCCEVQRIEEILSKKESERLDLLKHLKFISQETAELENNNHSLDGEM 125
                 D+   L     + + + ++ +K ES   +L   LK   +   ELE     L+GE 
Sbjct: 1010 EERVSDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGES 1069

Query: 126  KSCKNLLAESEKKVMKLEALVQDKDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYRLG 185
                  +AE + ++ +L+A +  K+  +++  A+LE+ +        +++  +     L 
Sbjct: 1070 SDLHEQIAELQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQ 1129

Query: 186  EELAGCQETLDTMLRQKEELRLQLAD 211
            E+L   +   +   +QK +L  +L  
Sbjct: 1130 EDLESEKAARNKAEKQKRDLSEELEA 1155


>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query224
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 99.26
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 99.24
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 98.63
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 98.59
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 98.45
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 98.36
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 97.82
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.6
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.59
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 97.57
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 97.14
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 96.87
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 96.87
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 96.86
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 96.81
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.79
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.79
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 96.78
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 96.76
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 96.74
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 96.66
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 96.65
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 96.45
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 96.36
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 96.32
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 95.98
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 95.79
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 95.75
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 95.53
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 95.32
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 95.23
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 95.21
3bas_A89 Myosin heavy chain, striated muscle/general contro 95.01
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 94.88
3bas_A89 Myosin heavy chain, striated muscle/general contro 94.82
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 94.76
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 94.72
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 94.67
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 94.65
1x8y_A86 Lamin A/C; structural protein, intermediate filame 94.62
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 94.47
2zqm_A117 Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 94.35
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 94.14
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 94.07
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 94.07
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 93.91
1gk4_A84 Vimentin; intermediate filament, dimer, parallel c 93.72
2no2_A107 HIP-I, huntingtin-interacting protein 1; clathrin 93.69
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 93.22
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 93.04
1fxk_A107 Prefoldin; archaeal protein, chaperone; 2.30A {Met 92.87
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 92.8
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 92.63
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 92.07
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 91.98
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 91.93
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 91.29
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 91.24
2v4h_A110 NF-kappa-B essential modulator; transcription, met 90.28
3mov_A95 Lamin-B1; LMNB1, B-type lamins, intermediate filam 90.13
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 89.29
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 88.75
2xzr_A114 Immunoglobulin-binding protein EIBD; cell adhesion 88.54
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 88.31
1m1j_B 464 Fibrinogen beta chain; coiled coils, disulfide rin 87.94
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 87.94
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 87.7
4h22_A103 Leucine-rich repeat flightless-interacting protei; 87.58
3jsv_C94 NF-kappa-B essential modulator; ubiquitin, coiled- 86.75
2v4h_A110 NF-kappa-B essential modulator; transcription, met 86.63
1deq_A 390 Fibrinogen (alpha chain); coiled-coil, blood clott 86.4
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 86.37
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 84.44
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 84.2
1fxk_C133 Protein (prefoldin); archaeal protein, chaperone; 83.51
1x8y_A86 Lamin A/C; structural protein, intermediate filame 82.89
2xnx_M146 M protein, M1-BC1; cell adhesion, virulence factor 82.75
1m1j_B 464 Fibrinogen beta chain; coiled coils, disulfide rin 81.97
2oto_A155 M protein; helical coiled coil, fibrinogen-binding 81.86
1gk4_A84 Vimentin; intermediate filament, dimer, parallel c 81.66
4emc_A190 Monopolin complex subunit CSM1; RWD domain, kineto 81.66
3trt_A77 Vimentin; cytoskeleton, intermediate filament, alp 81.49
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 80.75
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 80.45
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
Probab=99.26  E-value=5.4e-08  Score=80.95  Aligned_cols=68  Identities=15%  Similarity=0.168  Sum_probs=30.8

Q ss_pred             HHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchHHHH
Q psy5037         149 KDCSIKSLEAKLEELSHVTAQLETQVQCCQEEKYRLGEELAGCQETLDTMLRQKEELRLQLADTENYK  216 (224)
Q Consensus       149 ~~~~i~~~e~qL~~l~~~~~~lE~EL~~lk~er~~l~~dL~~~re~~~kld~~~e~l~~qL~~~~~~~  216 (224)
                      ....+..+...+..+...+..++..+..+......+...+..+...+..+......+...+..+....
T Consensus       200 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  267 (284)
T 1c1g_A          200 VTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKY  267 (284)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            33333333444444444444444444444444444444444444444444444444444444443333



>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A Back     alignment and structure
>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 Back     alignment and structure
>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>1fxk_C Protein (prefoldin); archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 Back     alignment and structure
>1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A Back     alignment and structure
>2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M Back     alignment and structure
>1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 Back     alignment and structure
>4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A Back     alignment and structure
>3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query224
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 93.3
d2ap3a1185 Hypothetical protein MW0975 (SA0943) {Staphylococc 89.47
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 85.37
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 82.79
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 81.25
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Prefoldin
family: Prefoldin
domain: Prefoldin beta subunit
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
Probab=93.30  E-value=0.46  Score=33.39  Aligned_cols=75  Identities=11%  Similarity=0.246  Sum_probs=37.8

Q ss_pred             HHHHHHHHHHHHHHHHhhhhhhhhhhhhhhhhHhH----------------------HHHHHHHHHHHHHhHHhhHHHHH
Q psy5037         100 LLKHLKFISQETAELENNNHSLDGEMKSCKNLLAE----------------------SEKKVMKLEALVQDKDCSIKSLE  157 (224)
Q Consensus       100 Lle~~~~l~~e~~~lE~r~~~lE~e~nel~le~~~----------------------~~~ri~~le~~I~e~~~~i~~~e  157 (224)
                      ...+|..+..++..+-..+..+++.+++..+-+..                      ..+=+..+..++......|..++
T Consensus         6 ~~~~~q~lq~el~~~~~q~~~le~q~~E~~~vl~eL~~l~~d~~vyk~vG~vLv~~~~~e~~~~l~~~~e~l~~~i~~l~   85 (107)
T d1fxka_           6 QLAQFQQLQQQAQAISVQKQTVEMQINETQKALEELSRAADDAEVYKSSGNILIRVAKDELTEELQEKLETLQLREKTIE   85 (107)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTCCEEEEETTEEEEECHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCcccHHHHHhcchhhcCcHHHHHHHHHHHHHHHHHHHHHHH
Confidence            44555555555555555555555555555444422                      23334444445555555555555


Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy5037         158 AKLEELSHVTAQLETQV  174 (224)
Q Consensus       158 ~qL~~l~~~~~~lE~EL  174 (224)
                      .++..+...+.++...+
T Consensus        86 ~q~~~l~~~l~~~~~~l  102 (107)
T d1fxka_          86 RQEERVMKKLQEMQVNI  102 (107)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            55555555544444444



>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure