Diaphorina citri psyllid: psy5045


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------
MLTPMFELLQSEEDVTIIIKAPYANIADTEVYVEDTDFRFSSSPYYLRLNFPGPIKETDHTSGKYDSDKGQFTFTVIKVNTGEHFPDLDLISKLLIPPVKHRVAKPGIEVMSEPNNVSDEDEDEDDDTMWFIEQEPQHQPEENSTTYGYGFANKTKGTLTNMKVTISKSDLGFDLEELETAARIVEEEEVERALCNHVSTLVLCSNSEQSERSIIFFIGLDFWVVSRDYASDVRQAQDDRTQMTPSELDTMKQLGNREYLLSSEEKCAVLLSLVNILYAYCYDVRTTMGEHTVESGWTVNKLSSALCWLQSFTSLKQVLISSMRRSLCYPLYREWRLSCAIQQDVNTILSQDILGYKVMKQVTISKSDLGFDLDELETAARIVEEEEVERALCNHVSTLVLCSDSEQ
ccccEEEEECcccEEEEEEEEcccccccEEEEECccEEEEEEcccEEEEccccccccccccEEEEEccccEEEEEEEEccccccccccccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccHHccHHHHHHHHHcccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcEECcccccccccccHHHHHccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEccccccc
MLTPMFELLQSEEDVTIIIKAPYANIADTEVYVEDTDFRFSSSPYYLRLNFPGPIKETDHTSGKYDSDKGQFTFTVIKVNTGEHFPDLDLISKLLIPPVKHRVA**********************DTMWFI**************YGYGFANKTKGTLTNMKVTISKSDLGFDLEELETAARIVEEEEVERALCNHVSTLVLCSNSEQSERSIIFFIGLDFWVVSRDYA***************************EYLLSSEEKCAVLLSLVNILYAYCYDVRTTMGEHTVESGWTVNKLSSALCWLQSFTSLKQVLISSMRRSLCYPLYREWRLSCAIQQDVNTILSQDILGYKVMKQVTISKSDLGFDLDELETAARIVEEEEVERALCNHVSTLVLC*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTPMFELLQSEEDVTIIIKAPYANIADTEVYVEDTDFRFSSSPYYLRLNFPGPIKETDHTSGKYDSDKGQFTFTVIKVNTGEHFPDLDLISKLLIPPVKHRVAKPGIEVMSEPNNVSDEDEDEDDDTMWFIEQEPQHQPEENSTTYGYGFANKTKGTLTNMKVTISKSDLGFDLEELETAARIVEEEEVERALCNHVSTLVLCSNSEQSERSIIFFIGLDFWVVSRDYASDVRQAQDDRTQMTPSELDTMKQLGNREYLLSSEEKCAVLLSLVNILYAYCYDVRTTMGEHTVESGWTVNKLSSALCWLQSFTSLKQVLISSMRRSLCYPLYREWRLSCAIQQDVNTILSQDILGYKVMKQVTISKSDLGFDLDELETAARIVEEEEVERALCNHVSTLVLCSDSEQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein SHQ1 homolog Required for the quantitative accumulation of H/ACA ribonucleoproteins (RNPs).confidentA1L1R0
Protein SHQ1 homolog Required for the quantitative accumulation of H/ACA ribonucleoproteins (RNPs), including telomerase, probably through the stabilization of DKC1, from the time of its synthesis until its association with NOP10, NHP2, and NAF1 at the nascent H/ACA RNA.confidentQ7TMX5
Protein SHQ1 homolog Required for the quantitative accumulation of H/ACA ribonucleoproteins (RNPs).confidentQ05B18

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ZUZ, chain A
Confidence level:very confident
Coverage over the Query: 143-372
View the alignment between query and template
View the model in PyMOL
Template: 2K8Q, chain A
Confidence level:very confident
Coverage over the Query: 1-115
View the alignment between query and template
View the model in PyMOL