Diaphorina citri psyllid: psy5052


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
YKKAGLDSINISLDTLKPDKYEFITRRKGWSRVLAGIDLAVQLGYDNLKVNVVVMKNFNDDEILDFVLLTRDRPIDVRFIEYMPFSGNQWNNTKIMPFSEMLTKIKEAHPDLLTLENAPNDTSKAYKVPEFKGQVGFITSMTEHFCGTCNRLRLMADGSLKVCLFGNTEISL
ccHccccccEEccccccHHHHHHHcccccHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHcccccEEEEEEcccccccccccccccHHHHHHHHHHHccccccccccccccccEEECcccccEEEEEcccccccccccccEEEcccccccccccccccccc
YKKAGLDSINISLDTLKPDKYEFITRRKGWSRVLAGIDLAVQLGYDNLKVNVVVMKNFNDDEILDFVLLTRDRPIDVRFIEYMPFSGNQWNNTKIMPFSEMLTKIKEAHPDLLTLE***NDTSKAYKVPEFKGQVGFITSMTEHFCGTCNRLRLMADGSLKVCLFGN*EI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YKKAGLDSINISLDTLKPDKYEFITRRKGWSRVLAGIDLAVQLGYDNLKVNVVVMKNFNDDEILDFVLLTRDRPIDVRFIEYMPFSGNQWNNTKIMPFSEMLTKIKEAHPDLLTLENAPNDTSKAYKVPEFKGQVGFITSMTEHFCGTCNRLRLMADGSLKVCLFGNTEISL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Molybdenum cofactor biosynthesis protein 1 Isoform Mocs1a and isoform Mocs1b probably form a complex that catalyzes the conversion of a guanosine derivative to precursor Z during molybdenum cofactor biosynthesis.confidentQ8IQF1
Molybdenum cofactor biosynthesis protein 1 Isoform MOCS1A and isoform MOCS1B probably form a complex that catalyzes the conversion of a guanosine derivative to precursor Z during molybdenum cofactor biosynthesis.confidentQ1JQD7
Molybdenum cofactor biosynthesis protein 1 Isoform Mocs1a and isoform Mocs1b probably form a complex that catalyzes the conversion of a guanosine derivative to precursor Z during molybdenum cofactor biosynthesis.confidentQ5RKZ7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623
GO:0032324 [BP]molybdopterin cofactor biosynthetic processprobableGO:0006732, GO:0044249, GO:0006807, GO:1901362, GO:1901360, GO:1901576, GO:0051186, GO:0044260, GO:0043545, GO:0051189, GO:0051188, GO:0071704, GO:0018130, GO:0044267, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0090407, GO:0046483, GO:0044238, GO:1901564, GO:1901566, GO:0019538, GO:0044237, GO:0043170, GO:0006796, GO:0006793, GO:0019637

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1TV8, chain A
Confidence level:very confident
Coverage over the Query: 1-172
View the alignment between query and template
View the model in PyMOL