Diaphorina citri psyllid: psy5056


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
TSRRQIQHSAEVSELPLHLSLRSTYFQEPPVARFNTRRKSVYAESYNPEDDEEDEGPKVIYPKSDEQRRSLAESDQMNDVIDAMFEKPVEAGDIVIRQGDDGDFFYVIESMNRAQLGKVSVPDELRDILLEFTISYLLEQPSDVIEYGVDFFTKLKLNRRTTPEEPTTPEDDIDDGPNERCY
ccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccCCccccHHHHHHcccccHHHHHHHHEEEEECccccEEEEEcccccEEEEEEcccccCEEEEcccccHHHHHHHHccEEEEECcccEEEEEEccHHHHHHccccccccccccccccccccccccc
*****************************************YAESYNPE****DEGPKVIYPKSDEQRRSLAESDQMNDVIDAMFEKPVEAGDIVIRQGDDGDFFYVIESMNRAQLGKVSVPDELRDILLEFTISYLLEQPSDVIEYGVDFFTKLKL*************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TSRRQIQHSAEVSELPLHLSLRSTYFQEPPVARFNTRRKSVYAESYNPEDDEEDEGPKVIYPKSDEQRRSLAESDQMNDVIDAMFEKPVEAGDIVIRQGDDGDFFYVIESMNRAQLGKVSVPDELRDILLEFTISYLLEQPSDVIEYGVDFFTKLKLNRRTTPEEPTTPEDDIDDGPNERCY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
cAMP-dependent protein kinase type II regulatory subunit confidentQ26619

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045859 [BP]regulation of protein kinase activityprobableGO:0042325, GO:0032268, GO:0019220, GO:0019222, GO:0050790, GO:0060255, GO:0051246, GO:0043549, GO:0031323, GO:0051338, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0065009, GO:0001932, GO:0050789, GO:0080090
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0031625 [MF]ubiquitin protein ligase bindingprobableGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0030552 [MF]cAMP bindingprobableGO:0043168, GO:0030551, GO:0030554, GO:0097159, GO:0003674, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032555, GO:0017076, GO:0000166, GO:1901363, GO:1901265, GO:0005488
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TNP, chain B
Confidence level:very confident
Coverage over the Query: 32-126,142-166
View the alignment between query and template
View the model in PyMOL