Psyllid ID: psy5056

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
TSRRQIQHSAEVSELPLHLSLRSTYFQEPPVARFNTRRKSVYAESYNPEDDEEDEGPKVIYPKSDEQRRSLAESDQMNDVIDAMFEKPVEAGDIVIRQGDDGDFFYVIESMNRAQLGKVSVPDELRDILLEFTISYLLEQPSDVIEYGVDFFTKLKLNRRTTPEEPTTPEDDIDDGPNERCY
ccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccEEccccHHHHHHcccccHHHHHHHHEEEEEEccccEEEEEcccccEEEEEEcccccEEEEEcccccHHHHHHHHccEEEEEEcccEEEEEEccHHHHHHHcccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccEEEEEEEcccccEEEEEEcccccEEEEEEEHHHHcccccHHHHHHHHHHHHHHHccccccccccccccccccccccccc
tsrrqiqhsaevselplhlslrstyfqeppvarfntrrksvyaesynpeddeedegpkviypksdeqrRSLAESDQMNDVIDAMFekpveagdivirqgddgdFFYVIESMNraqlgkvsvpDELRDILLEFTISYLleqpsdvieYGVDFFTklklnrrttpeepttpeddiddgpnercy
tsrrqiqhsaevselplhlslrstyfqeppvarfntrrkSVYAEsynpeddeedegpkviypksdEQRRSLAESDQMNDVIDAMFEKPVEAGDIVIRQGDDGDFFYVIESMNraqlgkvsvPDELRDILLEFTISYLLEQPSDVIEYGVDFFTKLklnrrttpeepttpeddiddgpnercy
TSRRQIQHSAEVSELPLHLSLRSTYFQEPPVARFNTRRKSVYAESYNPEDDEEDEGPKVIYPKSDEQRRSLAESDQMNDVIDAMFEKPVEAGDIVIRQGDDGDFFYVIESMNRAQLGKVSVPDELRDILLEFTISYLLEQPSDVIEYGVDFFTKLKLNRRttpeepttpeddiddgpNERCY
*******************************************************************************VIDAMFEKPVEAGDIVIRQGDDGDFFYVIESMNRAQLGKVSVPDELRDILLEFTISYLLEQPSDVIEYGVDFFTKLKL*************************
*****************************************YAESYNPE****DEGPKVIYPKSDEQRRSLAESDQMNDVIDAMFEKPVEAGDIVIRQGDDGDFFYVIESMNRAQLGKVSVPDELRDILLEFTISYLLEQPSDVIEYGVDFFTKLK*******************GPNE***
***********VSELPLHLSLRSTYFQEPPVARFNTRRKSVY*************GPKVIYPKSD********SDQMNDVIDAMFEKPVEAGDIVIRQGDDGDFFYVIESMNRAQLGKVSVPDELRDILLEFTISYLLEQPSDVIEYGVDFFTKLKLNRR**********************
***************************EPPVARFNTRRKSVYAESYNPEDDEEDEGPKVIYPKSDEQRRSLAESDQMNDVIDAMFEKPVEAGDIVIRQGDDGDFFYVIESMNRAQLGKVSVPDELRDILLEFTISYLLEQPSDVIEYGVDFFTKLKLN************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TSRRQIQHSAEVSELPLHLSLRSTYFQEPPVARFNTRRKSVYAESYNPEDDEEDEGPKVIYPKSDEQRRSLAESDQMNDVIDAMFEKPVEAGDIVIRQGDDGDFFYVIESMNRAQLGKVSVPDELRDILLEFTISYLLEQPSDVIEYGVDFFTKLKLNRRTTPEEPTTPEDDIDDGPNERCY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query182 2.2.26 [Sep-21-2011]
P81900 377 cAMP-dependent protein ki no N/A 0.450 0.217 0.547 7e-20
P31322 418 cAMP-dependent protein ki yes N/A 0.456 0.198 0.489 3e-17
P31323 418 cAMP-dependent protein ki yes N/A 0.456 0.198 0.489 4e-17
P13861 404 cAMP-dependent protein ki no N/A 0.439 0.198 0.526 6e-17
P12369 416 cAMP-dependent protein ki yes N/A 0.439 0.192 0.494 1e-16
P31324 416 cAMP-dependent protein ki yes N/A 0.439 0.192 0.494 2e-16
P12367 401 cAMP-dependent protein ki no N/A 0.450 0.204 0.5 2e-16
Q26619 369 cAMP-dependent protein ki yes N/A 0.445 0.219 0.521 6e-16
P00515 401 cAMP-dependent protein ki no N/A 0.439 0.199 0.494 2e-15
P12368 401 cAMP-dependent protein ki no N/A 0.445 0.201 0.5 2e-15
>sp|P81900|KAPR2_DROME cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster GN=Pka-R2 PE=1 SV=2 Back     alignment and function desciption
 Score = 96.7 bits (239), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 52/95 (54%), Positives = 68/95 (71%), Gaps = 13/95 (13%)

Query: 28  EPPVARFNTRRKSVYAESYNPEDDEEDEGPKVIYPKSDEQRRSLAES------------D 75
           EPPV   ++RRKSV+AE+Y+PE D++D+G   ++PK+DEQR  L ES            +
Sbjct: 73  EPPVMA-SSRRKSVFAEAYDPEADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKE 131

Query: 76  QMNDVIDAMFEKPVEAGDIVIRQGDDGDFFYVIES 110
           QMN V+DAMFE+ V+ GD +IRQGDDGD FYVIES
Sbjct: 132 QMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIES 166
Type II regulatory chains mediate membrane association by binding to anchoring proteins, including the MAP2 kinase. The regulatory subunit may play an essential role in the regulation of neuronal activity in the brain. Has a role in circadian locomotor rhythm, and behavioral response to cocaine and ethanol.
Drosophila melanogaster (taxid: 7227)
>sp|P31322|KAP3_BOVIN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Bos taurus GN=PRKAR2B PE=2 SV=2 Back     alignment and function description
>sp|P31323|KAP3_HUMAN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens GN=PRKAR2B PE=1 SV=3 Back     alignment and function description
>sp|P13861|KAP2_HUMAN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens GN=PRKAR2A PE=1 SV=2 Back     alignment and function description
>sp|P12369|KAP3_RAT cAMP-dependent protein kinase type II-beta regulatory subunit OS=Rattus norvegicus GN=Prkar2b PE=1 SV=3 Back     alignment and function description
>sp|P31324|KAP3_MOUSE cAMP-dependent protein kinase type II-beta regulatory subunit OS=Mus musculus GN=Prkar2b PE=1 SV=3 Back     alignment and function description
>sp|P12367|KAP2_MOUSE cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Mus musculus GN=Prkar2a PE=1 SV=2 Back     alignment and function description
>sp|Q26619|KAPR_STRPU cAMP-dependent protein kinase type II regulatory subunit OS=Strongylocentrotus purpuratus PE=2 SV=1 Back     alignment and function description
>sp|P00515|KAP2_BOVIN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Bos taurus GN=PRKAR2A PE=1 SV=2 Back     alignment and function description
>sp|P12368|KAP2_RAT cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Rattus norvegicus GN=Prkar2a PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
383862774 383 PREDICTED: cAMP-dependent protein kinase 0.456 0.216 0.631 9e-26
383862776 375 PREDICTED: cAMP-dependent protein kinase 0.456 0.221 0.631 1e-25
380029297 383 PREDICTED: cAMP-dependent protein kinase 0.456 0.216 0.621 1e-25
345492835 392 PREDICTED: cAMP-dependent protein kinase 0.456 0.211 0.625 6e-25
307202639 375 cAMP-dependent protein kinase type II re 0.456 0.221 0.610 7e-25
307181210 383 cAMP-dependent protein kinase type II re 0.456 0.216 0.610 9e-25
340719479 384 PREDICTED: cAMP-dependent protein kinase 0.456 0.216 0.6 1e-24
66517761 383 PREDICTED: cAMP-dependent protein kinase 0.456 0.216 0.6 1e-24
156554114 378 PREDICTED: cAMP-dependent protein kinase 0.456 0.219 0.614 2e-24
162462811 382 cAMP-dependent protein kinase R2 [Bombyx 0.461 0.219 0.583 3e-22
>gi|383862774|ref|XP_003706858.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
 Score =  122 bits (305), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 75/95 (78%), Gaps = 12/95 (12%)

Query: 27  QEPPVARFNTRRKSVYAESYNPEDDEEDEGPKVIYPKSDEQRRSLAES------------ 74
           +EPPVARF TRRKSV+AE+YNPE+DEED+G K+++PKSDEQR+ L+ES            
Sbjct: 72  EEPPVARFATRRKSVFAETYNPEEDEEDDGVKMVHPKSDEQRQRLSESVKNILLFRALDE 131

Query: 75  DQMNDVIDAMFEKPVEAGDIVIRQGDDGDFFYVIE 109
           +QM DV+DAMFEK V+ G+ +IRQGDDGD FYVIE
Sbjct: 132 EQMADVLDAMFEKTVQPGEFIIRQGDDGDNFYVIE 166

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383862776|ref|XP_003706859.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380029297|ref|XP_003698313.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like [Apis florea] Back     alignment and taxonomy information
>gi|345492835|ref|XP_003426938.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like isoform 6 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307202639|gb|EFN81960.1| cAMP-dependent protein kinase type II regulatory subunit [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307181210|gb|EFN68907.1| cAMP-dependent protein kinase type II regulatory subunit [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340719479|ref|XP_003398181.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like [Bombus terrestris] gi|350410475|ref|XP_003489052.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|66517761|ref|XP_392905.2| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit isoform 1 [Apis mellifera] gi|46847760|emb|CAG27571.1| cAMP-dependent protein kinase type II regulatory chain [Apis mellifera carnica] Back     alignment and taxonomy information
>gi|156554114|ref|XP_001601087.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like isoform 1 [Nasonia vitripennis] gi|345492826|ref|XP_003426934.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like isoform 2 [Nasonia vitripennis] gi|345492828|ref|XP_003426935.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like isoform 3 [Nasonia vitripennis] gi|345492831|ref|XP_003426936.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like isoform 4 [Nasonia vitripennis] gi|345492833|ref|XP_003426937.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like isoform 5 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|162462811|ref|NP_001104823.1| cAMP-dependent protein kinase R2 [Bombyx mori] gi|159498529|gb|ABW97443.1| cAMP-dependent protein kinase R2 [Bombyx mori] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
FB|FBgn0022382 377 Pka-R2 "cAMP-dependent protein 0.593 0.286 0.450 7e-22
ZFIN|ZDB-GENE-030131-1007 397 prkar2aa "protein kinase, cAMP 0.456 0.209 0.531 1e-18
UNIPROTKB|Q9BUB1 382 PRKAR2A "Protein kinase, cAMP- 0.445 0.212 0.536 1.9e-17
UNIPROTKB|P13861 404 PRKAR2A "cAMP-dependent protei 0.445 0.200 0.536 2.4e-17
MGI|MGI:97760 416 Prkar2b "protein kinase, cAMP 0.456 0.199 0.489 5.8e-17
RGD|3394 416 Prkar2b "protein kinase, cAMP 0.456 0.199 0.489 5.8e-17
UNIPROTKB|E2RRA1 417 PRKAR2B "Uncharacterized prote 0.456 0.199 0.489 5.9e-17
UNIPROTKB|F6Q9S4 418 PRKAR2B "cAMP-dependent protei 0.456 0.198 0.489 5.9e-17
UNIPROTKB|P31322 418 PRKAR2B "cAMP-dependent protei 0.456 0.198 0.489 5.9e-17
UNIPROTKB|P31323 418 PRKAR2B "cAMP-dependent protei 0.456 0.198 0.489 7.7e-17
FB|FBgn0022382 Pka-R2 "cAMP-dependent protein kinase R2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 255 (94.8 bits), Expect = 7.0e-22, P = 7.0e-22
 Identities = 55/122 (45%), Positives = 80/122 (65%)

Query:     1 TSRRQIQHSAEVSELPLHLSLRSTYFQEPPVARFNTRRKSVYAESYNPEDDEEDEGPKVI 60
             + R  + H+ + ++  L ++ +     EPPV   ++RRKSV+AE+Y+PE D++D+G   +
Sbjct:    47 SERPSVSHTDQSTDDQLSVNSQDAD-AEPPVMA-SSRRKSVFAEAYDPEADDDDDGATAV 104

Query:    61 YPKSDEQRRSLAES------------DQMNDVIDAMFEKPVEAGDIVIRQGDDGDFFYVI 108
             +PK+DEQR  L ES            +QMN V+DAMFE+ V+ GD +IRQGDDGD FYVI
Sbjct:   105 FPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVI 164

Query:   109 ES 110
             ES
Sbjct:   165 ES 166
GO:0008603 "cAMP-dependent protein kinase regulator activity" evidence=ISS;NAS
GO:0005737 "cytoplasm" evidence=IDA
GO:0005952 "cAMP-dependent protein kinase complex" evidence=IEA;ISS;NAS
GO:0006468 "protein phosphorylation" evidence=ISS
GO:0005515 "protein binding" evidence=IPI
GO:0048148 "behavioral response to cocaine" evidence=NAS;IMP
GO:0048149 "behavioral response to ethanol" evidence=NAS;IMP;TAS
GO:0007623 "circadian rhythm" evidence=NAS;IMP
GO:0045475 "locomotor rhythm" evidence=NAS;IMP
GO:0007622 "rhythmic behavior" evidence=TAS
GO:0007165 "signal transduction" evidence=IEA
GO:0001932 "regulation of protein phosphorylation" evidence=IEA
GO:0007411 "axon guidance" evidence=IMP
ZFIN|ZDB-GENE-030131-1007 prkar2aa "protein kinase, cAMP-dependent, regulatory, type II, alpha A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BUB1 PRKAR2A "Protein kinase, cAMP-dependent, regulatory, type II, alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P13861 PRKAR2A "cAMP-dependent protein kinase type II-alpha regulatory subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:97760 Prkar2b "protein kinase, cAMP dependent regulatory, type II beta" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3394 Prkar2b "protein kinase, cAMP dependent regulatory, type II beta" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRA1 PRKAR2B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6Q9S4 PRKAR2B "cAMP-dependent protein kinase type II-beta regulatory subunit" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P31322 PRKAR2B "cAMP-dependent protein kinase type II-beta regulatory subunit" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P31323 PRKAR2B "cAMP-dependent protein kinase type II-beta regulatory subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q26619KAPR_STRPUNo assigned EC number0.52120.44500.2195yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
cd1209939 cd12099, DD_RII_PKA, Dimerization/Docking domain o 8e-10
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 4e-07
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 3e-06
cd1210441 cd12104, DD_RIIbeta_PKA, Dimerization/Docking doma 6e-04
pfam0219738 pfam02197, RIIa, Regulatory subunit of type II PKA 9e-04
smart0039438 smart00394, RIIa, RIIalpha, Regulatory subunit por 0.001
cd1210341 cd12103, DD_RIIalpha_PKA, Dimerization/Docking dom 0.002
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 0.003
cd1208437 cd12084, DD_R_PKA, Dimerization/Docking domain of 0.004
>gnl|CDD|213046 cd12099, DD_RII_PKA, Dimerization/Docking domain of the Type II Regulatory subunit of cAMP-dependent protein kinase Back     alignment and domain information 
 Score = 51.5 bits (124), Expect = 8e-10
 Identities = 16/39 (41%), Positives = 28/39 (71%)

Query: 121 VPDELRDILLEFTISYLLEQPSDVIEYGVDFFTKLKLNR 159
           +P  L ++L +FT+  L EQPSD++++  ++FTKL+  R
Sbjct: 1   IPPGLTELLQDFTVEVLREQPSDLVDFAAEYFTKLREER 39

cAMP-dependent protein kinase (PKA) is a serine/threonine kinase (STK), catalyzing the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active subunits. There are two classes of R subunits, RI and RII; each exists as two isoforms (alpha and beta) from distinct genes. These functionally non-redundant R isoforms allow for specificity in PKA signaling. RII subunits contain a phosphorylation site in their inhibitory site and are both substrates and inhibitors. RIIalpha plays a role in the association and dissociation of PKA with the centrosome during interphase and mitosis, respectively. RIIbeta plays an important role in adipocytes and neuronal tissues. The R subunit contains an N-terminal dimerization/docking (D/D) domain, a linker with an inhibitory sequence, and two c-AMP binding domains. The D/D domain dimerizes to form a four-helix bundle that serves as a docking site for A-kinase-anchoring proteins (AKAPs), which facilitates the localization of PKA to specific sites in the cell. PKA is present ubiquitously in cells and interacts with many different downstream targets. It plays a role in the regulation of diverse processes such as growth, development, memory, metabolism, gene expression, immunity, and lipolysis. Length = 39
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>gnl|CDD|213051 cd12104, DD_RIIbeta_PKA, Dimerization/Docking domain of the Type II beta Regulatory subunit of cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|202148 pfam02197, RIIa, Regulatory subunit of type II PKA R-subunit Back     alignment and domain information
>gnl|CDD|197697 smart00394, RIIa, RIIalpha, Regulatory subunit portion of type II PKA R-subunit Back     alignment and domain information
>gnl|CDD|213050 cd12103, DD_RIIalpha_PKA, Dimerization/Docking domain of the Type II alpha Regulatory subunit of cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213043 cd12084, DD_R_PKA, Dimerization/Docking domain of the Regulatory subunit of cAMP-dependent protein kinase and similar domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 182
KOG1113|consensus 368 99.88
KOG1113|consensus368 99.77
KOG0614|consensus 732 99.65
KOG0614|consensus 732 99.63
COG0664 214 Crp cAMP-binding proteins - catabolite gene activa 98.51
PRK09392 236 ftrB transcriptional activator FtrB; Provisional 98.37
PLN03192 823 Voltage-dependent potassium channel; Provisional 98.36
PRK11753 211 DNA-binding transcriptional dual regulator Crp; Pr 98.33
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 98.3
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 98.24
KOG0498|consensus 727 98.24
cd00038115 CAP_ED effector domain of the CAP family of transc 98.23
PRK10402 226 DNA-binding transcriptional activator YeiL; Provis 98.16
PF0219738 RIIa: Regulatory subunit of type II PKA R-subunit; 98.14
PLN02868 413 acyl-CoA thioesterase family protein 98.12
PRK13918 202 CRP/FNR family transcriptional regulator; Provisio 98.03
KOG0500|consensus 536 97.93
PRK11161235 fumarate/nitrate reduction transcriptional regulat 97.85
KOG0499|consensus 815 97.7
smart0039438 RIIa RIIalpha, Regulatory subunit portion of type 97.56
TIGR03697 193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 97.32
PRK09391230 fixK transcriptional regulator FixK; Provisional 97.29
COG2905 610 Predicted signal-transduction protein containing c 96.2
KOG2968|consensus 1158 95.23
KOG0501|consensus 971 90.81
>KOG1113|consensus Back     alignment and domain information 
Probab=99.88  E-value=2.3e-22  Score=176.23  Aligned_cols=110  Identities=41%  Similarity=0.572  Sum_probs=97.9

Q ss_pred             cCCcccceeeeeecCCCCCCCCCCCceeCCCCHHHHHHHHhH------------HHHHHHHhhcccceecCCCEEEecCC
Q psy5056          33 RFNTRRKSVYAESYNPEDDEEDEGPKVIYPKSDEQRRSLAES------------DQMNDVIDAMFEKPVEAGDIVIRQGD  100 (182)
Q Consensus        33 ~~~~RR~sVsAE~~~~~~~~~~~~~~~~~pKs~~~~~~I~~a------------~~l~~i~d~m~~~~~~~Ge~II~qGd  100 (182)
                      ....||++||||+++++.   ..+...++||+++++++|.++            +++..|+|+|+++.+++|+.||.|||
T Consensus        85 ~~~~RRssV~aE~~tp~~---d~~~~~~~pKd~e~~~~L~~a~r~~~LF~~Ld~eq~~~v~dam~~~~v~~G~~Vi~qGd  161 (368)
T KOG1113|consen   85 VLFVRRSSVSAEEITPDD---DEFKRKYIPKDDETRRRLEEAFRKNLLFANLDDEQLSQVLDAMFEKRVKAGETVIKQGD  161 (368)
T ss_pred             ccccccceeeeeecCccc---hhhhhcCCCCCHHHHHHHHHHHHhccccccCCHHHHHHHHHhhceeeecCCcEEEecCC
Confidence            344899999999999886   457788999999999999999            99999999999999999999999999


Q ss_pred             CCCeEEEEEeCceeeeccccCchhhHHHHHHHHHhhhhcCCCccccchh-hhhhhhhhccCCCCCCCC
Q psy5056         101 DGDFFYVIESMNRAQLGKVSVPDELRDILLEFTISYLLEQPSDVIEYGV-DFFTKLKLNRRTTPEEPT  167 (182)
Q Consensus       101 ~Gd~fYII~~G~v~V~k~~~~~~G~~~lL~~~t~~vl~~qp~~l~~~~~-dyFGELall~~~pr~~~~  167 (182)
                      .||+||||++|+++|+++..                      -|.++.. .+||||||+.+.||+|..
T Consensus       162 eGd~fYvI~kGt~dVyv~~~----------------------~v~~~~~g~sFGElALmyn~PRaATv  207 (368)
T KOG1113|consen  162 EGDNFYVIDKGTFDVYVNGT----------------------YVTTYSPGGSFGELALMYNPPRAATV  207 (368)
T ss_pred             cCCcEEEEecceEEEEECCe----------------------EEeeeCCCCchhhhHhhhCCCcccce
Confidence            99999999999999998721                      1445556 999999999999999943

>KOG1113|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PF02197 RIIa: Regulatory subunit of type II PKA R-subunit; InterPro: IPR003117 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>smart00394 RIIa RIIalpha, Regulatory subunit portion of type II PKA R-subunit Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
3tnp_B 416 Structure And Allostery Of The Pka Riib Tetrameric 1e-17
3idc_B164 Crystal Structure Of (102-265)riib:c Holoenzyme Of 2e-17
2qvs_B 310 Crystal Structure Of Type Iia Holoenzyme Of Camp-De 3e-17
3tnq_A 416 Structure And Allostery Of The Pka Riib Tetrameric 4e-17
3idb_B161 Crystal Structure Of (108-268)riib:c Holoenzyme Of 1e-16
1cx4_A 305 Crystal Structure Of A Deletion Mutant Of The Type 4e-15
3pvb_B160 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 2e-06
2qcs_B 291 A Complex Structure Between The Catalytic And Regul 2e-05
1ne4_A 283 Crystal Structure Of Rp-Camp Binding R1a Subunit Of 2e-05
1rl3_A 288 Crystal Structure Of Camp-free R1a Subunit Of Pka L 2e-05
3fhi_B154 Crystal Structure Of A Complex Between The Catalyti 2e-05
4din_B 381 Novel Localization And Quaternary Structure Of The 2e-05
3tmh_B48 Crystal Structure Of Dual-Specific A-Kinase Anchori 2e-04
1l6e_A46 Solution Structure Of The Docking And Dimerization 3e-04
3of1_A 246 Crystal Structure Of Bcy1, The Yeast Regulatory Sub 3e-04
2izy_A54 Molecular Basis Of Akap Specificity For Pka Regulat 4e-04
>pdb|3TNP|B Chain B, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 Back     alignment and structure 
Iteration: 1

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 64/93 (68%), Gaps = 13/93 (13%)
Query: 29  PPVARFNTRRKSVYAESYNPEDDEEDEGPKVIYPKSDEQRRSLAES------------DQ 76
           P + RF TRR SV AE+YNP+++E+D   ++I+PK+D+QR  L E+            +Q
Sbjct: 102 PVINRF-TRRASVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQ 160
Query: 77  MNDVIDAMFEKPVEAGDIVIRQGDDGDFFYVIE 109
           M+ V+DAMFEK V+ G+ VI QGDDGD FYVI+
Sbjct: 161 MSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVID 193
>pdb|3IDC|B Chain B, Crystal Structure Of (102-265)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 164 Back     alignment and structure
>pdb|2QVS|B Chain B, Crystal Structure Of Type Iia Holoenzyme Of Camp-Dependent Protein Kinase Length = 310 Back     alignment and structure
>pdb|3TNQ|A Chain A, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 Back     alignment and structure
>pdb|3IDB|B Chain B, Crystal Structure Of (108-268)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 161 Back     alignment and structure
>pdb|1CX4|A Chain A, Crystal Structure Of A Deletion Mutant Of The Type Ii Beta Regulatory Subunit Of Camp-Dependent Protein Kinase Length = 305 Back     alignment and structure
>pdb|3PVB|B Chain B, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 160 Back     alignment and structure
>pdb|2QCS|B Chain B, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 291 Back     alignment and structure
>pdb|1NE4|A Chain A, Crystal Structure Of Rp-Camp Binding R1a Subunit Of Camp- Dependent Protein Kinase Length = 283 Back     alignment and structure
>pdb|1RL3|A Chain A, Crystal Structure Of Camp-free R1a Subunit Of Pka Length = 288 Back     alignment and structure
>pdb|3FHI|B Chain B, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 154 Back     alignment and structure
>pdb|4DIN|B Chain B, Novel Localization And Quaternary Structure Of The Pka Ri Beta Holoenzyme Length = 381 Back     alignment and structure
>pdb|3TMH|B Chain B, Crystal Structure Of Dual-Specific A-Kinase Anchoring Protein 2 In Complex With Camp-Dependent Protein Kinase A Type Ii Alpha And Pdzk1 Length = 48 Back     alignment and structure
>pdb|1L6E|A Chain A, Solution Structure Of The Docking And Dimerization Domain Of Protein Kinase A Ii-Alpha (Riialpha DD). ALTERNATIVELY Called The N-Terminal Dimerization Domain Of The Regulatory Subunit Of Protein Kinase A. Length = 46 Back     alignment and structure
>pdb|3OF1|A Chain A, Crystal Structure Of Bcy1, The Yeast Regulatory Subunit Of Pka Length = 246 Back     alignment and structure
>pdb|2IZY|A Chain A, Molecular Basis Of Akap Specificity For Pka Regulatory Subunits Length = 54 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 7e-26
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 5e-23
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 4e-20
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 2e-08
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 6e-05
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 1e-17
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 1e-05
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 1e-16
4din_B381 CAMP-dependent protein kinase type I-beta regulat 1e-05
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 5e-14
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 5e-13
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 2e-06
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 4e-12
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 6e-07
2izy_A54 CAMP-dependent protein kinase regulatory subunit I 2e-11
2kyg_A50 CAMP-dependent protein kinase type II-alpha regul 9e-11
2izx_A41 CAMP-dependent protein kinase type II-alpha regula 3e-10
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 4e-10
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 2e-06
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 2e-06
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 2e-06
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 3e-06
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 9e-06
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 9e-06
2pqq_A149 Putative transcriptional regulator; APC7345, strep 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 3e-04
2oz6_A 207 Virulence factor regulator; winged helix, helix-tu 7e-04
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
 Score = 96.3 bits (240), Expect = 7e-26
 Identities = 44/98 (44%), Positives = 62/98 (63%), Gaps = 18/98 (18%)

Query: 36  TRRKSVYAESYNPEDDEEDEGPKVIYPKSDEQRRSLAES------------DQMNDVIDA 83
           TRR SV AE+YNP+++E+D   ++I+PK+D+QR  L E+            +QM+ V+DA
Sbjct: 1   TRRASVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDA 60

Query: 84  MFEKPVEAGDIVIRQGDDGDFFYVIESMNRAQLGKVSV 121
           MFEK V+ G+ VI QGDDGD FYVI+       G   +
Sbjct: 61  MFEKLVKEGEHVIDQGDDGDNFYVIDR------GTFDI 92
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>2izy_A CAMP-dependent protein kinase regulatory subunit II; D/D, RII, PKA, acetylation, transferase, CAMP- binding, phosphorylation, nucleotide-binding; 2.2A {Mus musculus} SCOP: a.31.1.1 PDB: 1l6e_A 1r2a_A 2drn_A 2h9r_A Length = 54 Back     alignment and structure
>2kyg_A CAMP-dependent protein kinase type II-alpha regul subunit; protein/protein, homodimer bound to monomer, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2izx_A CAMP-dependent protein kinase type II-alpha regulatory subunit; CAMP-binding, phosphorylation, nucleotide-binding, PKA, CAMP, anchor, kinase, acetylation; 1.3A {Homo sapiens} PDB: 2hwn_A Length = 41 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 99.75
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.67
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 99.66
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.59
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 99.58
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.32
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.31
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.26
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.26
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.24
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.23
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.21
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.2
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.16
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.14
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 99.01
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 98.96
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 98.91
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 98.91
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 98.9
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 98.87
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 98.86
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 98.83
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 98.82
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 98.82
2pqq_A149 Putative transcriptional regulator; APC7345, strep 98.81
3ukn_A212 Novel protein similar to vertebrate potassium VOL 98.78
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 98.78
1zyb_A 232 Transcription regulator, CRP family; NP_813211.1, 98.74
3fx3_A 237 Cyclic nucleotide-binding protein; helix_TURN_heli 98.72
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 98.71
4ev0_A 216 Transcription regulator, CRP family; CAMP binding, 98.68
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 98.68
3e97_A 231 Transcriptional regulator, CRP/FNR family; YP_6044 98.68
3dkw_A 227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 98.68
3d0s_A 227 Transcriptional regulatory protein; CAMP receptor 98.68
2oz6_A 207 Virulence factor regulator; winged helix, helix-tu 98.67
2gau_A 232 Transcriptional regulator, CRP/FNR family; structu 98.66
3ryp_A 210 Catabolite gene activator; CAMP receptor protein ( 98.65
3iwz_A 230 CAP-like, catabolite activation-like protein; XCC, 98.62
3kcc_A 260 Catabolite gene activator; helix-turn-helix, CAMP, 98.62
3dv8_A 220 Transcriptional regulator, CRP/FNR family; cyclic 98.6
3la7_A 243 Global nitrogen regulator; activator, DNA-binding, 98.46
2bgc_A 238 PRFA; bacterial infection, human pathogen, transcr 98.45
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 98.43
3b02_A 195 Transcriptional regulator, CRP family; structural 98.39
1o5l_A 213 Transcriptional regulator, CRP family; TM1171, str 98.37
2izx_A41 CAMP-dependent protein kinase type II-alpha regula 98.23
2zcw_A 202 TTHA1359, transcriptional regulator, FNR/CRP famil 98.19
3e6c_C 250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 98.15
2kyg_A50 CAMP-dependent protein kinase type II-alpha regul 98.12
2izy_A54 CAMP-dependent protein kinase regulatory subunit I 98.06
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 98.04
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 97.99
1ft9_A 222 Carbon monoxide oxidation system transcription reg 97.82
4f9k_A95 CAMP-dependent protein kinase type I-beta regulat 97.12
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
Probab=99.75  E-value=2.2e-18  Score=152.69  Aligned_cols=121  Identities=44%  Similarity=0.626  Sum_probs=94.3

Q ss_pred             CCccccCCcccceeeeeecCCCCCCCCCCCceeCCCCHHHHHHHHhH------------HHHHHHHhhcccceecCCCEE
Q psy5056          28 EPPVARFNTRRKSVYAESYNPEDDEEDEGPKVIYPKSDEQRRSLAES------------DQMNDVIDAMFEKPVEAGDIV   95 (182)
Q Consensus        28 ~~~~~~~~~RR~sVsAE~~~~~~~~~~~~~~~~~pKs~~~~~~I~~a------------~~l~~i~d~m~~~~~~~Ge~I   95 (182)
                      ++|+.++.+||.+||||+++++..+...+.++++||+++++++|.++            .++..|+++|..+.|++|++|
T Consensus       100 ~~~~~~~~~rr~~v~ae~~~~~~~~~~~~~~~~~~ks~~~~~~i~~~L~~~~lF~~L~~~~l~~l~~~~~~~~~~~Ge~I  179 (416)
T 3tnp_B          100 NAPVINRFTRRASVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHV  179 (416)
T ss_dssp             -----CTTSCCCCEECCCCCCC--------CCCCCCCHHHHHHHHHHHTTSHHHHTCCHHHHHHHHHHCEEEEECTTCEE
T ss_pred             CCCCcccCCCccEEeccccCCcccccccccccCCCCCHHHHHHHHHHHhCCHhHhcCCHHHHHHHHHhcEEEEeCCCCEE
Confidence            35556667899999999999887655667788999999999999988            899999999999999999999


Q ss_pred             EecCCCCCeEEEEEeCceeeeccccCchhhHHHHHHHHHhhhhcCCCccccchh-hhhhhhhhccCCCCCCC
Q psy5056          96 IRQGDDGDFFYVIESMNRAQLGKVSVPDELRDILLEFTISYLLEQPSDVIEYGV-DFFTKLKLNRRTTPEEP  166 (182)
Q Consensus        96 I~qGd~Gd~fYII~~G~v~V~k~~~~~~G~~~lL~~~t~~vl~~qp~~l~~~~~-dyFGELall~~~pr~~~  166 (182)
                      |+|||.|+.||||.+|.|+|++.   .+|..               ..+..+.. ++|||++++.+.||++.
T Consensus       180 ~~qGd~~d~~YiI~sG~v~v~~~---~~G~~---------------~~v~~l~~G~~fGe~all~~~pr~at  233 (416)
T 3tnp_B          180 IDQGDDGDNFYVIDRGTFDIYVK---CDGVG---------------RCVGNYDNRGSFGELALMYNTPKAAT  233 (416)
T ss_dssp             ECTTSCCCEEEEEEECEEEEEEE---CSSCE---------------EEEEEEESCCEECGGGGTSCCCCSSE
T ss_pred             EeCCCCCceEEEEEeeEEEEEEe---cCCCE---------------EEEEEecCCCEEeeHHHhcCCCcccE
Confidence            99999999999999999999973   23321               11445555 99999999999999873
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>2izx_A CAMP-dependent protein kinase type II-alpha regulatory subunit; CAMP-binding, phosphorylation, nucleotide-binding, PKA, CAMP, anchor, kinase, acetylation; 1.3A {Homo sapiens} PDB: 2hwn_A Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>2kyg_A CAMP-dependent protein kinase type II-alpha regul subunit; protein/protein, homodimer bound to monomer, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2izy_A CAMP-dependent protein kinase regulatory subunit II; D/D, RII, PKA, acetylation, transferase, CAMP- binding, phosphorylation, nucleotide-binding; 2.2A {Mus musculus} SCOP: a.31.1.1 PDB: 1l6e_A 1r2a_A 2drn_A 2h9r_A Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>4f9k_A CAMP-dependent protein kinase type I-beta regulat subunit; structural genomics, PSI-biology; 2.80A {Homo sapiens} PDB: 2ezw_A 3im3_A 3im4_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 182
d2hwna139 a.31.1.1 (A:5-43) cAMP-dependent protein kinase ty 1e-10
d1cx4a1136 b.82.3.2 (A:130-265) Regulatory subunit of Protein 6e-10
d1ne6a1136 b.82.3.2 (A:109-244) Regulatory subunit of Protein 3e-07
d2oz6a2134 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protei 2e-04
d1o7fa3124 b.82.3.2 (A:322-445) Regulatory domain of Epac2, d 0.001
d2gaua2142 b.82.3.2 (A:10-151) Transcriptional regulator PG03 0.001
d1i5za2132 b.82.3.2 (A:6-137) Catabolite gene activator prote 0.002
>d2hwna1 a.31.1.1 (A:5-43) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 39 Back     information, alignment and structure

class: All alpha proteins
fold: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit
superfamily: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit
family: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit
domain: cAMP-dependent protein kinase type II regulatory subunit
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 52.0 bits (125), Expect = 1e-10
 Identities = 13/39 (33%), Positives = 27/39 (69%)

Query: 121 VPDELRDILLEFTISYLLEQPSDVIEYGVDFFTKLKLNR 159
           +P  L ++L  +T+  L +QP D++++ V++FT+L+  R
Sbjct: 1   IPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREAR 39
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 142 Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.55
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.42
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.17
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.15
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.12
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.12
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.04
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 98.9
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 98.9
d1i5za2132 Catabolite gene activator protein, N-terminal doma 98.81
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 98.78
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 98.76
d2hwna139 cAMP-dependent protein kinase type II regulatory s 98.76
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 98.72
d1zyba2147 Probable transcription regulator BT4300, N-termina 98.67
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 98.62
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 98.39
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 98.09
d2ezwa150 cAMP-dependent protein kinase type I-alpha regulat 95.3
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Regulatory subunit of Protein kinase A
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.55  E-value=2.8e-15  Score=111.08  Aligned_cols=90  Identities=42%  Similarity=0.578  Sum_probs=77.1

Q ss_pred             eeCCCCHHHHHHHHhH------------HHHHHHHhhcccceecCCCEEEecCCCCCeEEEEEeCceeeeccccCchhhH
Q psy5056          59 VIYPKSDEQRRSLAES------------DQMNDVIDAMFEKPVEAGDIVIRQGDDGDFFYVIESMNRAQLGKVSVPDELR  126 (182)
Q Consensus        59 ~~~pKs~~~~~~I~~a------------~~l~~i~d~m~~~~~~~Ge~II~qGd~Gd~fYII~~G~v~V~k~~~~~~G~~  126 (182)
                      .+|||++++++.|.+.            +++..|+++|..+.|++|++|++|||.++.||+|.+|.|+++....   |..
T Consensus         2 ~~~~kt~~~~~~l~~~l~~~~~F~~l~~~~~~~l~~~~~~~~~~~g~~I~~~G~~~~~~y~I~~G~v~v~~~~~---~~~   78 (136)
T d1cx4a1           2 IIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCD---GVG   78 (136)
T ss_dssp             CCCCCCHHHHHHHHHHHTTCGGGTTCCHHHHHHHHHHCEEEEECTTCEEECTTSCCCEEEEEEECEEEEEEEET---TEE
T ss_pred             ccccCCHHHHHHHHHHHhCCHhhhcCCHHHHHHHhcceEEEEECCCCEEEECCCcchhhhhhhhheeEEeeccc---cce
Confidence            5799999999999876            9999999999999999999999999999999999999999986532   211


Q ss_pred             HHHHHHHHhhhhcCCCccccchh-hhhhhhhhccCCCCCCC
Q psy5056         127 DILLEFTISYLLEQPSDVIEYGV-DFFTKLKLNRRTTPEEP  166 (182)
Q Consensus       127 ~lL~~~t~~vl~~qp~~l~~~~~-dyFGELall~~~pr~~~  166 (182)
                                     ..+..+.. ++||+++++.+.||++.
T Consensus        79 ---------------~~~~~l~~g~~fg~~~l~~~~~~~~s  104 (136)
T d1cx4a1          79 ---------------RCVGNYDNRGSFGELALMYNTPRAAT  104 (136)
T ss_dssp             ---------------EEEEEEESSCEECHHHHHHCCCCCSE
T ss_pred             ---------------eeeeccCCccccchHHHhCCCcceEE
Confidence                           11455666 99999999999999863
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hwna1 a.31.1.1 (A:5-43) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2ezwa1 a.31.1.1 (A:12-61) cAMP-dependent protein kinase type I-alpha regulatory subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure