Diaphorina citri psyllid: psy5091


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MGDPNDKTLRKLEKDVLIEQMMRDIARTEKCAEFTEALEKCGRDNGWKGVFTCRKENEKMKECMAHWYHNEDFRKEVTEMYLQQRTDYRKTGLSKKMRKELESLGYEINIKS
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHcccc
******KTLRKLEKDVLIEQMMRDIARTEKCAEFTEALEKCGRDNGWKGVFTCRKENEKMKECMAHWYHNEDFRKEVTEMYLQQRTDY************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDPNDKTLRKLEKDVLIEQMMRDIARTEKCAEFTEALEKCGRDNGWKGVFTCRKENEKMKECMAHWYHNEDFRKEVTEMYLQQRTDYRKTGLSKKMRKELESLGYEINIKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
COX assembly mitochondrial protein homolog Required for mitochondrial cytochrome c oxidase (COX) assembly and respiration. Binds copper. May be involved in copper trafficking and distribution to COX and SOD1.confidentQ7Z7K0
COX assembly mitochondrial protein homolog Required for mitochondrial cytochrome c oxidase (COX) assembly and respiration. Binds copper. May be involved in copper trafficking and distribution to COX and SOD1.confidentQ9CPZ8
COX assembly mitochondrial protein homolog Required for mitochondrial cytochrome c oxidase (COX) assembly and respiration. Binds copper. May be involved in copper trafficking and distribution to mitochondrial COX and SOD1.confidentQ3SZM6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LQT, chain A
Confidence level:probable
Coverage over the Query: 52-94
View the alignment between query and template
View the model in PyMOL
Template: 2LQL, chain A
Confidence level:probable
Coverage over the Query: 25-67
View the alignment between query and template
View the model in PyMOL