Required for mitochondrial cytochrome c oxidase (COX) assembly and respiration. Binds copper. May be involved in copper trafficking and distribution to COX and SOD1. Homo sapiens (taxid: 9606)
Required for mitochondrial cytochrome c oxidase (COX) assembly and respiration. Binds copper. May be involved in copper trafficking and distribution to mitochondrial COX and SOD1.
Score = 82.0 bits (201), Expect = 1e-15, Method: Compositional matrix adjust.
Identities = 40/96 (41%), Positives = 64/96 (66%), Gaps = 1/96 (1%)
Query: 3 DPNDKTLRKLEKDVLIEQMMRDIARTEKCAEFTEALEKCGRDNGWKGVFTCRKENEKMKE 62
DP ++ LR +EKDVLI +++R+ AR E+C+E E +C +D+G V CRKEN +K+
Sbjct: 4 DPAEQHLRHVEKDVLIPKIIREKAR-ERCSEQVEDFTRCCKDSGILMVLKCRKENSALKD 62
Query: 63 CMAHWYHNEDFRKEVTEMYLQQRTDYRKTGLSKKMR 98
C+ +Y++ F +E YL++R ++RKTG+ K R
Sbjct: 63 CLTAYYNDPAFYEECKLEYLKEREEFRKTGVPTKKR 98
Required for mitochondrial cytochrome c oxidase (COX) assembly and respiration. Binds copper. May be involved in copper trafficking and distribution to COX and SOD1.
Mus musculus (taxid: 10090)
Close Homologs in the Non-Redundant Database Detected by BLAST
Score = 103 (41.3 bits), Expect = 9.0e-06, P = 9.0e-06
Identities = 21/58 (36%), Positives = 32/58 (55%)
Query: 19 EQMMRDIARTE---KCAEFTEALEKCGRDNGWKGVFTCRKENEKMKECMAHWYHNEDF 73
EQ R +TE KCA F +A+ C + NG K TC K+ ++MK C+ + +E +
Sbjct: 27 EQQARKNLKTETYKKCANFVQAMADCAKANGMKVFPTCDKQRDEMKSCLLFYQTDEKY 84
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.316 0.132 0.393 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 112 112 0.00091 102 3 11 22 0.48 30
29 0.43 32
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 9
No. of states in DFA: 576 (61 KB)
Total size of DFA: 134 KB (2084 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 15.09u 0.09s 15.18t Elapsed: 00:00:02
Total cpu time: 15.09u 0.09s 15.18t Elapsed: 00:00:02
Start: Thu Aug 15 11:35:44 2013 End: Thu Aug 15 11:35:46 2013
GO:0033617 "mitochondrial respiratory chain complex IV assembly" evidence=IGI;IMP
Score = 53.1 bits (128), Expect = 9e-11
Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
Query: 22 MRDIART---EKCAEFTEALEKCGRDNGWKGVFTCRKENEKMKECMAHWYHNEDFRKEVT 78
M + R +KCAE +AL +C + K C K+ M +C+ + +E R
Sbjct: 1 MHPLLRKKARKKCAELIKALAECHKGRTLKAFGKCNKQKRAMNKCLKQYRKDEALRDREK 60
Query: 79 EMYLQQR 85
+ Y+++R
Sbjct: 61 DEYIKER 67
Cmc1 is a metallo-chaperone like protein which is known to localise to the inner mitochondrial membrane in Saccharomyces cerevisiae. It is essential for full expression of cytochrome c oxidase and respiration. Cmc1 contains two Cx9C motifs and is able to bind copper(I). Cmc1 is thought to play a role in mitochondrial copper trafficking and transfer to cytochrome c oxidase. Length = 69
>PF08583 Cmc1: Cytochrome c oxidase biogenesis protein Cmc1 like; InterPro: IPR013892 Cmc1 is a metallo-chaperone like protein which is known to localise to the inner mitochondrial membrane in Saccharomyces cerevisiae
It is essential for full expression of cytochrome c oxidase and respiration []. Cmc1 contains two Cx9C motifs and is able to bind copper(I). Cmc1 is thought to play a role in mitochondrial copper trafficking and transfer to cytochrome c oxidase.
>PF06747 CHCH: CHCH domain; InterPro: IPR010625 A conserved motif was identified in the LOC118487 protein was called the CHCH motif
Alignment of this protein with related members showed the presence of three subgroups of proteins, which are called the S (Small), N (N-terminal extended) and C (C-terminal extended) subgroups. All three sub-groups of proteins have in common that they contain a predicted conserved [coiled coil 1]-[helix 1]-[coiled coil 2]-[helix 2] domain (CHCH domain). Within each helix of the CHCH domain, there are two cysteines present in a C-X9-C motif. The N-group contains an additional double helix domain, and each helix contains the C-X9-C motif. This family contains a number of characterised proteins: Cox19 protein - a nuclear gene of Saccharomyces cerevisiae, codes for an 11 kDa protein (Cox19p) required for expression of cytochrome oxidase. Because cox19 mutants are able to synthesise the mitochondrial and nuclear gene products of cytochrome oxidase, Cox19p probably functions post-translationally during assembly of the enzyme. Cox19p is present in the cytoplasm and mitochondria, where it exists as a soluble intermembrane protein. This dual location is similar to what was previously reported for Cox17p, a low molecular weight copper protein thought to be required for maturation of the CuA centre of subunit 2 of cytochrome oxidase. Cox19p have four conserved potential metal ligands, these are three cysteines and one histidine. Mrp10 - belongs to the class of yeast mitochondrial ribosomal proteins that are essential for translation []. Eukaryotic NADH-ubiquinone oxidoreductase 19 kDa (NDUFA8) subunit []. The CHCH domain was previously called DUF657 []. ; PDB: 2ZXT_A 3A3C_A 2L0Y_A 2K3J_A.
>PF07802 GCK: GCK domain; InterPro: IPR012891 This domain is found in proteins carrying other domains known to be involved in intracellular signalling pathways (such as IPR001806 from INTERPRO) indicating that it might also be involved in these pathways
It has 4 highly conserved cysteine residues, suggesting that it can bind zinc ions. Moreover, it is found repeated in some members of this family (such as Q9LMF3 from SWISSPROT); this may indicate that these domains are able to interact with one another, raising the possibility that this domain mediates heterodimerisation.
>PF10200 Ndufs5: NADH:ubiquinone oxidoreductase, NDUFS5-15kDa; InterPro: IPR019342 Proteins in this entry form part of the NADH:ubiquinone oxidoreductase complex I
Complex I is the first multisubunit inner membrane protein complex of the mitochondrial electron transport chain and it transfers two electrons from NADH to ubiquinone. The mammalian complex I is composed of 45 different subunits. The proteins in this entry represent a component of the iron-sulphur (IP) fragment of the enzyme, that is not involved in catalysis. These proteins carry four highly conserved cysteine residues, but these do not appear to be in a configuration which would favour metal binding, so the exact function of the protein is uncertain [].
