Diaphorina citri psyllid: psy5112


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MEVLSILLKNPYHHSLPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDKNLEHYLEPELKVSQTKGKYPLKIYVMLCDVISKWETALREKGTGKFENNRCVQFIYKNRLYFRSLSKKETDRERLLLCYQTNQQVVLGRFPLTKELALELAALLSQVCFKQVG
ccEEEEEccccccccccCEEEEEECcccEEEEEEcccccHHHHHHHHHHHcccccccccCEEEEECccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEEccccccccccHHHHHHHHHHHHHcHHcccccccHHHHHHHHHHHHHHHHcccc
MEVLSILLKNPYHHSLPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDKNLEHYLEPELKVSQTKGKYPLKIYVMLCDVISKWETALREKGTGKFENNRCVQFIYKNRLYFRSLSKKETDRERLLLCYQTNQQVVLGRFPLTKELALELAALLSQVCFKQVG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVLSILLKNPYHHSLPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDKNLEHYLEPELKVSQTKGKYPLKIYVMLCDVISKWETALREKGTGKFENNRCVQFIYKNRLYFRSLSKKETDRERLLLCYQTNQQVVLGRFPLTKELALELAALLSQVCFKQVG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pleckstrin homology domain-containing family H member 1 confidentQ9ULM0
Pleckstrin homology domain-containing family H member 1 confidentQ80TI1
Uncharacterized protein CG42248 confidentQ9W5D0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PVL, chain A
Confidence level:very confident
Coverage over the Query: 1-82,98-184
View the alignment between query and template
View the model in PyMOL