Psyllid ID: psy5112

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MEVLSILLKNPYHHSLPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDKNLEHYLEPELKVSQTKGKYPLKIYVMLCDVISKWETALREKGTGKFENNRCVQFIYKNRLYFRSLSKKETDRERLLLCYQTNQQVVLGRFPLTKELALELAALLSQVCFKQVG
ccEEEEEccccccccccEEEEEEEEcccEEEEEEcccccHHHHHHHHHHHcccccccccEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEEccccccccccHHHHHHHHHHHHHcHHcccccccHHHHHHHHHHHHHHHHcccc
ccEHHHHHccccccccccEEEEEEcccEEEEEEEccccHHHHHHHHHHHHHcccccccccEEEEEcccccccHHHHccccEEEccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccc
MEVLSILlknpyhhslphsipvhllngayqvtgfdgsTTIEEFLQTLNSeidcrdsnvsgfalfsddpidknlehylepelkvsqtkgkyplKIYVMLCDVISKWETALrekgtgkfennrcvqfiyKNRLYFRSLSKKETDRERLLLCYQtnqqvvlgrfPLTKELALELAALLSQVCFKQVG
MEVLSILLKNPYHHSLPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDKNLEHylepelkvsqtkgkypLKIYVMLCDVISKWETALrekgtgkfennrcvqfiyknrlyfrsLSKKETDRERLLLCYqtnqqvvlGRFPLTKELALELAALLSQVCFKQVG
MEVLSILLKNPYHHSLPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDKNLEHYLEPELKVSQTKGKYPLKIYVMLCDVISKWETALREKGTGKFENNRCVQFIYKNRLYFRSLSKKETDRERLLLCYQTNQQVVLGRFPLTKelalelaallSQVCFKQVG
***LSILLKNPYHHSLPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDKNLEHYLEPELKVSQTKGKYPLKIYVMLCDVISKWETALREKGTGKFENNRCVQFIYKNRLYFRSLSKKETDRERLLLCYQTNQQVVLGRFPLTKELALELAALLSQVCFK***
MEVLSI*LKNPYHHSLPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDK*********************KIYVMLCDVISK******************VQFIYKNRLYFRSLSKKETDRERLLLCYQTNQQVVLGRFPLTKELALELAALLSQVCFKQVG
MEVLSILLKNPYHHSLPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDKNLEHYLEPELKVSQTKGKYPLKIYVMLCDVISKWETALREKGTGKFENNRCVQFIYKNRLYFRSLSKKETDRERLLLCYQTNQQVVLGRFPLTKELALELAALLSQVCFKQVG
MEVLSILLKNPYHHSLPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDKNLEHYLEPELKVSQTKGKYPLKIYVMLCDVISKWETALREKGTGKFENNRCVQFIYKNRLYFRSLSKKETDRERLLLCYQTNQQVVLGRFPLTKELALELAALLSQVCFKQV*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVLSILLKNPYHHSLPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDKNLEHYLEPELKVSQTKGKYPLKIYVMLCDVISKWETALREKGTGKFENNRCVQFIYKNRLYFRSLSKKETDRERLLLCYQTNQQVVLGRFPLTKELALELAALLSQVCFKQVG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query184 2.2.26 [Sep-21-2011]
Q9W5D0 1820 Uncharacterized protein C yes N/A 0.880 0.089 0.668 7e-65
Q00IB7 1433 Pleckstrin homology domai yes N/A 0.885 0.113 0.573 2e-54
Q9ULM0 1364 Pleckstrin homology domai yes N/A 0.885 0.119 0.575 6e-54
Q8IVE3 1493 Pleckstrin homology domai no N/A 0.885 0.109 0.573 9e-54
Q80TI1 1356 Pleckstrin homology domai yes N/A 0.885 0.120 0.569 3e-53
Q8C115 1491 Pleckstrin homology domai no N/A 0.885 0.109 0.556 1e-46
>sp|Q9W5D0|Y34F_DROME Uncharacterized protein CG42248 OS=Drosophila melanogaster GN=CG42248 PE=1 SV=4 Back     alignment and function desciption
 Score =  246 bits (627), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 119/178 (66%), Positives = 139/178 (78%), Gaps = 16/178 (8%)

Query: 1    MEVLSILLKNPYHHSLPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSG 60
            MEVLSILLKNPYHHSLPH+IPVH++N  YQV  FDGSTTIEEF  TL  E+  RD+  +G
Sbjct: 1372 MEVLSILLKNPYHHSLPHAIPVHMMNSTYQVVSFDGSTTIEEFQATLAHELGTRDA-TNG 1430

Query: 61   FALFSDDPIDKNLEHYLEPELKVSQTKGKYPLKIYVMLCDVISKWETALREKGTGKFENN 120
            F LFSDDPI+K+LEHYLEP  K               LCDVISKWETALREKG+GKFEN+
Sbjct: 1431 FCLFSDDPIEKDLEHYLEPLAK---------------LCDVISKWETALREKGSGKFENS 1475

Query: 121  RCVQFIYKNRLYFRSLSKKETDRERLLLCYQTNQQVVLGRFPLTKELALELAALLSQV 178
            R +Q  YKNRLY++   K ETD+ERLLLCYQTN Q+V GRFPL++ELALELA+L+SQ+
Sbjct: 1476 RVIQLSYKNRLYWKHTIKCETDKERLLLCYQTNSQIVQGRFPLSRELALELASLMSQI 1533

Drosophila melanogaster (taxid: 7227)
>sp|Q00IB7|PKHH1_DANRE Pleckstrin homology domain-containing family H member 1 OS=Danio rerio GN=plekhh1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ULM0|PKHH1_HUMAN Pleckstrin homology domain-containing family H member 1 OS=Homo sapiens GN=PLEKHH1 PE=2 SV=2 Back     alignment and function description
>sp|Q8IVE3|PKHH2_HUMAN Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens GN=PLEKHH2 PE=2 SV=2 Back     alignment and function description
>sp|Q80TI1|PKHH1_MOUSE Pleckstrin homology domain-containing family H member 1 OS=Mus musculus GN=Plekhh1 PE=2 SV=2 Back     alignment and function description
>sp|Q8C115|PKHH2_MOUSE Pleckstrin homology domain-containing family H member 2 OS=Mus musculus GN=Plekhh2 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
332019326 1369 Uncharacterized protein [Acromyrmex echi 0.907 0.121 0.659 6e-67
322786087 1315 hypothetical protein SINV_16195 [Solenop 0.907 0.126 0.659 6e-67
242025092 1525 conserved hypothetical protein [Pediculu 0.885 0.106 0.679 4e-66
357601756 1358 plekhh1 [Danaus plexippus] 0.885 0.120 0.657 5e-66
328716777 1308 PREDICTED: uncharacterized protein CG422 0.907 0.127 0.725 9e-66
328786640 1350 PREDICTED: uncharacterized protein CG422 0.907 0.123 0.648 2e-65
380029718 1328 PREDICTED: uncharacterized protein CG422 0.907 0.125 0.648 2e-65
350400839 1558 PREDICTED: uncharacterized protein CG422 0.907 0.107 0.648 3e-65
340719317 1597 PREDICTED: uncharacterized protein CG422 0.907 0.104 0.648 3e-65
307199370 1243 Uncharacterized protein CG12467 [Harpegn 0.907 0.134 0.648 3e-65
>gi|332019326|gb|EGI59832.1| Uncharacterized protein [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  258 bits (660), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 120/182 (65%), Positives = 142/182 (78%), Gaps = 15/182 (8%)

Query: 1    MEVLSILLKNPYHHSLPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSG 60
            MEVLSIL+KNPYHHSLPH+IPVH LNG YQV  FDGSTTIEEFL TLN EI CRD + SG
Sbjct: 983  MEVLSILMKNPYHHSLPHAIPVHFLNGTYQVVSFDGSTTIEEFLNTLNQEIGCRDVHQSG 1042

Query: 61   FALFSDDPIDKNLEHYLEPELKVSQTKGKYPLKIYVMLCDVISKWETALREKGTGKFENN 120
            F LFSDDPI+K+LEH+++PE K               LCD+ISKWETALREKG+GKFEN 
Sbjct: 1043 FTLFSDDPIEKDLEHFIDPEAK---------------LCDIISKWETALREKGSGKFENT 1087

Query: 121  RCVQFIYKNRLYFRSLSKKETDRERLLLCYQTNQQVVLGRFPLTKELALELAALLSQVCF 180
            R +Q  YK+R Y+R  +K ETD+ERLLLCYQ NQQVV G+FPL +ELA ELA+L++Q+ F
Sbjct: 1088 RVIQLTYKSRCYWRQAAKMETDKERLLLCYQVNQQVVQGKFPLNRELAFELASLMAQIDF 1147

Query: 181  KQ 182
             +
Sbjct: 1148 GE 1149

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322786087|gb|EFZ12698.1| hypothetical protein SINV_16195 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|242025092|ref|XP_002432960.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518469|gb|EEB20222.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|357601756|gb|EHJ63140.1| plekhh1 [Danaus plexippus] Back     alignment and taxonomy information
>gi|328716777|ref|XP_001952006.2| PREDICTED: uncharacterized protein CG42248-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328786640|ref|XP_001120273.2| PREDICTED: uncharacterized protein CG42248-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380029718|ref|XP_003698513.1| PREDICTED: uncharacterized protein CG42248-like [Apis florea] Back     alignment and taxonomy information
>gi|350400839|ref|XP_003485980.1| PREDICTED: uncharacterized protein CG42248-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340719317|ref|XP_003398101.1| PREDICTED: uncharacterized protein CG42248-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307199370|gb|EFN79995.1| Uncharacterized protein CG12467 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
FB|FBgn0264449 1820 CG43867 [Drosophila melanogast 0.880 0.089 0.623 7.6e-52
UNIPROTKB|E1BF01 1362 PLEKHH1 "Uncharacterized prote 0.885 0.119 0.553 4.1e-43
ZFIN|ZDB-GENE-061219-1 1433 plekhh1 "pleckstrin homology d 0.885 0.113 0.528 7.4e-43
UNIPROTKB|E2R725 1493 PLEKHH2 "Uncharacterized prote 0.885 0.109 0.528 1e-42
UNIPROTKB|F6Y875 1493 PLEKHH2 "Uncharacterized prote 0.885 0.109 0.528 1e-42
UNIPROTKB|F1S5I5 827 PLEKHH2 "Uncharacterized prote 0.885 0.197 0.516 3.6e-42
UNIPROTKB|Q8IVE3 1493 PLEKHH2 "Pleckstrin homology d 0.885 0.109 0.528 4.4e-42
UNIPROTKB|F1MH50 1404 PLEKHH2 "Uncharacterized prote 0.885 0.116 0.522 1.1e-41
UNIPROTKB|I3LFD9 1235 PLEKHH2 "Uncharacterized prote 0.885 0.131 0.516 1.1e-41
UNIPROTKB|E1BVF6 1509 E1BVF6 "Uncharacterized protei 0.885 0.108 0.513 1.2e-41
FB|FBgn0264449 CG43867 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 552 (199.4 bits), Expect = 7.6e-52, P = 7.6e-52
 Identities = 111/178 (62%), Positives = 129/178 (72%)

Query:     1 MEVLSILLKNPYHHSLPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSG 60
             MEVLSILLKNPYHHSLPH+IPVH++N  YQV  FDGSTTIEEF  TL  E+  RD+  +G
Sbjct:  1372 MEVLSILLKNPYHHSLPHAIPVHMMNSTYQVVSFDGSTTIEEFQATLAHELGTRDAT-NG 1430

Query:    61 FALFSDDPIDKNLEHYLEPELKVSQTKGKYPLKIYVMLCDVISKWETALREKGTGKFENN 120
             F LFSDDPI+K+LEHYLEP  K               LCDVISKWETALREKG+GKFEN+
Sbjct:  1431 FCLFSDDPIEKDLEHYLEPLAK---------------LCDVISKWETALREKGSGKFENS 1475

Query:   121 RCVQFIYKNRLYFRSLSKKETDRERLLLCYQTNQQVVLGRFPLTKXXXXXXXXXXSQV 178
             R +Q  YKNRLY++   K ETD+ERLLLCYQTN Q+V GRFPL++          SQ+
Sbjct:  1476 RVIQLSYKNRLYWKHTIKCETDKERLLLCYQTNSQIVQGRFPLSRELALELASLMSQI 1533
GO:0008150 "biological_process" evidence=ND
GO:0005856 "cytoskeleton" evidence=IEA
GO:0005543 "phospholipid binding" evidence=IEA
UNIPROTKB|E1BF01 PLEKHH1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061219-1 plekhh1 "pleckstrin homology domain containing, family H (with MyTH4 domain) member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R725 PLEKHH2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6Y875 PLEKHH2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S5I5 PLEKHH2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IVE3 PLEKHH2 "Pleckstrin homology domain-containing family H member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MH50 PLEKHH2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LFD9 PLEKHH2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVF6 E1BVF6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q80TI1PKHH1_MOUSENo assigned EC number0.56980.88580.1202yesN/A
Q9ULM0PKHH1_HUMANNo assigned EC number0.57540.88580.1195yesN/A
Q9W5D0Y34F_DROMENo assigned EC number0.66850.88040.0890yesN/A
Q00IB7PKHH1_DANRENo assigned EC number0.57300.88580.1137yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
smart00295201 smart00295, B41, Band 4 7e-14
pfam00373113 pfam00373, FERM_M, FERM central domain 6e-05
>gnl|CDD|214604 smart00295, B41, Band 4 Back     alignment and domain information 
 Score = 66.2 bits (162), Expect = 7e-14
 Identities = 45/160 (28%), Positives = 67/160 (41%), Gaps = 34/160 (21%)

Query: 20  IPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDKNLEHYLEP 79
           + V+LL+G       D STT EE L+T+  ++  R+S    F L  +DP D++L H+L+P
Sbjct: 2   LKVYLLDGTTLEFEVDSSTTAEELLETVCRKLGIRESE--YFGLQFEDP-DEDLRHWLDP 58

Query: 80  ELKVSQTKGKYPLKIYVMLCDVISKWETALREKGTGKFENNRCVQFIYKNRLYFRSLSKK 139
                             L D   K E                    ++ + Y    ++ 
Sbjct: 59  AKT---------------LLDQDVKSEPL---------------TLYFRVKFYPPDPNQL 88

Query: 140 ETDRERL-LLCYQTNQQVVLGRFPLTKELALELAALLSQV 178
           + D  RL LL  Q    ++ GR P  +E AL LAAL  Q 
Sbjct: 89  KEDPTRLNLLYLQVRNDILEGRLPCPEEEALLLAALALQA 128

1 homologues. Also known as ezrin/radixin/moesin (ERM) protein domains. Present in myosins, ezrin, radixin, moesin, protein tyrosine phosphatases. Plasma membrane-binding domain. These proteins play structural and regulatory roles in the assembly and stabilization of specialized plasmamembrane domains. Some PDZ domain containing proteins bind one or more of this family. Now includes JAKs. Length = 201
>gnl|CDD|215882 pfam00373, FERM_M, FERM central domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
smart00295207 B41 Band 4.1 homologues. Also known as ezrin/radix 99.95
KOG3530|consensus 616 99.88
KOG0248|consensus 936 99.84
KOG4261|consensus 1003 99.78
KOG0792|consensus 1144 99.75
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 99.5
cd0178785 GRB7_RA RA (RAS-associated like) domain of Grb7. G 99.48
KOG3527|consensus 975 99.46
KOG3529|consensus 596 99.43
KOG3552|consensus 1298 99.36
PF00373126 FERM_M: FERM central domain; InterPro: IPR019748 T 99.34
smart0031490 RA Ras association (RalGDS/AF-6) domain. RasGTP ef 98.97
PF0078893 RA: Ras association (RalGDS/AF-6) domain; InterPro 98.95
cd0176887 RA RA (Ras-associating) ubiquitin domain. The RA ( 98.91
KOG3784|consensus 407 98.62
cd0177787 SNX27_RA Ubiquitin domain of SNX27 (sorting nexin 98.54
KOG3751|consensus 622 98.46
KOG3531|consensus 1036 98.28
cd0177896 RASSF1_RA Ubiquitin-like domain of RASSF1 tumour s 97.68
cd0177687 Rin1_RA Ubiquitin domain of RIN1 RAS effector. Rin 97.35
cd0177597 CYR1_RA Ubiquitin domain of CYR1 adenylate cyclase 97.34
cd0178487 rasfadin_RA Ubiquitin-like domain of Rasfadin. ras 97.34
cd0176072 RBD Ubiquitin-like domain of RBD-like S/T kinases. 97.19
cd0178397 DAGK_delta_RA Ubiquitin-like domain of Diacylgylce 97.06
cd0178585 PDZ_GEF_RA Ubiquitin-like domain of PDZ_GEF_RA. PD 97.03
KOG4371|consensus 1332 96.94
cd01782112 AF6_RA_repeat1 Ubiquitin domain of AT-6, first rep 96.94
PF0219671 RBD: Raf-like Ras-binding domain; InterPro: IPR003 96.86
cd0181773 RGS12_RBD Ubiquitin domain of RGS12 and RGS14. RGS 96.83
smart0045570 RBD Raf-like Ras-binding domain. 96.8
KOG1574|consensus 375 96.66
KOG4257|consensus 974 96.66
cd01781100 AF6_RA_repeat2 Ubiquitin domain of AT-6, second re 96.61
PF14847105 Ras_bdg_2: Ras-binding domain of Byr2; PDB: 1I35_A 96.55
KOG4229|consensus 1062 96.13
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 95.93
KOG2378|consensus 573 95.85
cd01779105 Myosin_IXb_RA ubitquitin-like domain of Myosin_IXb 95.82
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 95.54
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 95.35
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 95.3
cd0181877 TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleo 95.08
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 94.92
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 94.88
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 94.88
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 94.8
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 94.76
PTZ0004476 ubiquitin; Provisional 94.6
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 94.45
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 94.42
KOG4239|consensus348 94.4
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 94.25
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 94.15
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 93.71
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 93.67
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 93.57
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 93.42
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 93.22
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 93.1
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 92.83
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 92.73
smart0016680 UBX Domain present in ubiquitin-regulatory protein 92.46
PF0282460 TGS: TGS domain; InterPro: IPR004095 The TGS domai 92.27
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 92.09
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 92.05
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 92.01
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 91.75
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 91.72
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 91.44
cd0015387 RalGDS_RA Ubiquitin domain of RalGDS-like factor ( 90.72
cd0178698 STE50_RA Ubiquitin-like domain of STE50_RA. STE50_ 90.69
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 90.16
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 90.0
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 89.83
KOG1892|consensus 1629 89.81
cd0640886 PB1_NoxR The PB1 domain is present in the Epichloe 89.06
KOG4371|consensus 1332 88.73
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 88.65
cd0181674 Raf_RBD Ubiquitin domain of Raf serine/threonine k 88.23
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 87.98
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 87.04
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 86.86
KOG4335|consensus 558 85.5
cd0599281 PB1 The PB1 domain is a modular domain mediating s 84.74
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 84.25
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 83.41
PF13019162 Telomere_Sde2: Telomere stability and silencing 83.27
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 83.05
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 83.02
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 82.85
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 82.79
cd0178093 PLC_epsilon_RA Ubiquitin-like domain of Phosphatid 82.56
PF0088787 ACBP: Acyl CoA binding protein; InterPro: IPR00058 82.41
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 81.79
cd0043585 ACBP Acyl CoA binding protein (ACBP) binds thiol e 81.2
>smart00295 B41 Band 4 Back     alignment and domain information 
Probab=99.95  E-value=1.8e-27  Score=189.92  Aligned_cols=136  Identities=32%  Similarity=0.406  Sum_probs=117.3

Q ss_pred             CCeEEEEEEecCCEEEEEEcCCCCHHHHHHHHHHHhCCCCCCCceeEEEEeCCCCCCcccccCcchhhccccCCCcccee
Q psy5112          16 LPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDKNLEHYLEPELKVSQTKGKYPLKIY   95 (184)
Q Consensus        16 ~pi~~~V~llDg~~~~v~vdsstT~~e~~~~i~~klgL~~~~~~gFsL~~~~~~~~~~~~~l~~~~k~~~~~~~~~~~~~   95 (184)
                      .|+.++|+++||+..++.+|++||++|+++.||+++||.  ...+||||+....+ +...|+.+..+             
T Consensus         2 ~~~~~~V~l~dg~~~~~~~~~~~t~~ev~~~v~~~~~l~--~~~~F~L~~~~~~~-~~~~~l~~~~~-------------   65 (207)
T smart00295        2 KPRVLKVYLLDGTTLEFEVDSSTTAEELLETVCRKLGIR--ESEYFGLQFEDPDE-DLSHWLDPAKT-------------   65 (207)
T ss_pred             CcEEEEEEecCCCEEEEEECCCCCHHHHHHHHHHHhCCC--ccceeEEEEEcCCC-CcCeeCCCccC-------------
Confidence            589999999999999999999999999999999999998  78999999987621 22368877765             


Q ss_pred             eeeehhHHHHHHHHHHhCCCcccCCceeEEEEeeeeeecCC-CCCCChhhHHhHHHhhhhhhhcCCCCCCHHHHHHHHHH
Q psy5112          96 VMLCDVISKWETALREKGTGKFENNRCVQFIYKNRLYFRSL-SKKETDRERLLLCYQTNQQVVLGRFPLTKELALELAAL  174 (184)
Q Consensus        96 ~~i~D~l~~we~~~~~~~~~~~~~~~~~~l~fr~k~f~~~~-~~~~d~~e~~l~y~Q~~~~v~~G~~p~~~e~a~~LAAl  174 (184)
                        ++|...+|               .+++|+||+|+|+++. ....|+.+..++|.|++++|++|++||+.++|++|||+
T Consensus        66 --l~~~~~~~---------------~~~~l~fr~r~~~~~~~~~~~d~~~~~~ly~Q~~~di~~g~~~~~~~~~~~Laal  128 (207)
T smart00295       66 --LLDQDVKS---------------EPLTLYFRVKFYPPDPLQLKEDPTRLNLLYLQVRNDILEGRLPCPEEEALLLAAL  128 (207)
T ss_pred             --HHHhcCCC---------------CCcEEEEEEEEccCCHHHhcchhHHHHHHHHHHHHHHHcCccCCCHHHHHHHHHH
Confidence              66654322               3589999999999874 34568888889999999999999999999999999999


Q ss_pred             HHhHhhcCCC
Q psy5112         175 LSQVCFKQVG  184 (184)
Q Consensus       175 ~~Q~e~Gd~~  184 (184)
                      ++|+++||++
T Consensus       129 ~~q~~~gd~~  138 (207)
T smart00295      129 ALQAEFGDYD  138 (207)
T ss_pred             HHHHHhcCCC
Confidence            9999999985

1 homologues. Also known as ezrin/radixin/moesin (ERM) protein domains. Present in myosins, ezrin, radixin, moesin, protein tyrosine phosphatases. Plasma membrane-binding domain. These proteins play structural and regulatory roles in the assembly and stabilization of specialized plasmamembrane domains. Some PDZ domain containing proteins bind one or more of this family. Now includes JAKs.
>KOG3530|consensus Back     alignment and domain information
>KOG0248|consensus Back     alignment and domain information
>KOG4261|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>cd01787 GRB7_RA RA (RAS-associated like) domain of Grb7 Back     alignment and domain information
>KOG3527|consensus Back     alignment and domain information
>KOG3529|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4 Back     alignment and domain information
>smart00314 RA Ras association (RalGDS/AF-6) domain Back     alignment and domain information
>PF00788 RA: Ras association (RalGDS/AF-6) domain; InterPro: IPR000159 Proteins with this domain are mostly RasGTP effectors and include guanine-nucleotide releasing factor in mammals [] Back     alignment and domain information
>cd01768 RA RA (Ras-associating) ubiquitin domain Back     alignment and domain information
>KOG3784|consensus Back     alignment and domain information
>cd01777 SNX27_RA Ubiquitin domain of SNX27 (sorting nexin protein 27) Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>cd01778 RASSF1_RA Ubiquitin-like domain of RASSF1 tumour supproessor protein Back     alignment and domain information
>cd01776 Rin1_RA Ubiquitin domain of RIN1 RAS effector Back     alignment and domain information
>cd01775 CYR1_RA Ubiquitin domain of CYR1 adenylate cyclase Back     alignment and domain information
>cd01784 rasfadin_RA Ubiquitin-like domain of Rasfadin Back     alignment and domain information
>cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases Back     alignment and domain information
>cd01783 DAGK_delta_RA Ubiquitin-like domain of Diacylgylcerol kinase (DAGK) Back     alignment and domain information
>cd01785 PDZ_GEF_RA Ubiquitin-like domain of PDZ_GEF_RA Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>cd01782 AF6_RA_repeat1 Ubiquitin domain of AT-6, first repeat Back     alignment and domain information
>PF02196 RBD: Raf-like Ras-binding domain; InterPro: IPR003116 This is the Ras-binding domain found in proteins related to Ras Back     alignment and domain information
>cd01817 RGS12_RBD Ubiquitin domain of RGS12 and RGS14 Back     alignment and domain information
>smart00455 RBD Raf-like Ras-binding domain Back     alignment and domain information
>KOG1574|consensus Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>cd01781 AF6_RA_repeat2 Ubiquitin domain of AT-6, second repeat Back     alignment and domain information
>PF14847 Ras_bdg_2: Ras-binding domain of Byr2; PDB: 1I35_A 1K8R_B Back     alignment and domain information
>KOG4229|consensus Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>KOG2378|consensus Back     alignment and domain information
>cd01779 Myosin_IXb_RA ubitquitin-like domain of Myosin_IXb_RA Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01818 TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleotide exchange factor Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>KOG4239|consensus Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>PF02824 TGS: TGS domain; InterPro: IPR004095 The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) [] Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>cd00153 RalGDS_RA Ubiquitin domain of RalGDS-like factor (RLF) and related proteins Back     alignment and domain information
>cd01786 STE50_RA Ubiquitin-like domain of STE50_RA Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>cd01816 Raf_RBD Ubiquitin domain of Raf serine/threonine kinases Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>KOG4335|consensus Back     alignment and domain information
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information
>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>PF13019 Telomere_Sde2: Telomere stability and silencing Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd01780 PLC_epsilon_RA Ubiquitin-like domain of Phosphatidylinositide-specific phospholipase Back     alignment and domain information
>PF00887 ACBP: Acyl CoA binding protein; InterPro: IPR000582 Acyl-CoA-binding protein (ACBP) is a small (10 Kd) protein that binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters [] Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>cd00435 ACBP Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
4dxa_B 322 KREV interaction trapped protein 1; GTPase, FERM, 2e-20
3au4_A 555 Myosin-X; protein-protein complex, motor protein c 2e-20
3pvl_A 655 Myosin VIIA isoform 1; protein complex, novel fold 5e-18
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 1e-05
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} Length = 322 Back     alignment and structure
 Score = 85.4 bits (211), Expect = 2e-20
 Identities = 24/167 (14%), Positives = 57/167 (34%), Gaps = 25/167 (14%)

Query: 17  PHSIPVHLLNGAYQVTGFD--GSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDKNLE 74
              + ++ ++G+Y+        +TT+++ ++ +    + +      F ++      +NL 
Sbjct: 5   FEKVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQ----YFTIWI---CSENLS 57

Query: 75  HYLEPELKVSQTKGKYPLKIYVMLCDVISKWETALREKGTGKFEN-NRCVQFIYKNRLYF 133
             L+P  K                   +  W   L E      +     +      RL  
Sbjct: 58  LQLKPYHK---------------PLQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPL 102

Query: 134 RSLSKKETDRERLLLCYQTNQQVVLGRFPLTKELALELAALLSQVCF 180
               + E     L+L  +    ++ G +       + LA+LL Q+ +
Sbjct: 103 EVEKQIEDPLAILILFDEARYNLLKGFYTAPDAKLITLASLLLQIVY 149
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Length = 555 Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Length = 655 Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Length = 371 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
3au4_A 555 Myosin-X; protein-protein complex, motor protein c 99.97
3pvl_A 655 Myosin VIIA isoform 1; protein complex, novel fold 99.97
3qij_A 296 Protein 4.1; cytoskeleton, structural genomics, st 99.97
4dxa_B 322 KREV interaction trapped protein 1; GTPase, FERM, 99.96
1h4r_A 314 Merlin; FERM, neurofibromatosis, NF2, structural p 99.96
1ef1_A 294 Moesin; membrane, FERM domain, tail domain, membra 99.96
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 99.95
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 99.94
2al6_A 375 Focal adhesion kinase 1; transferase; 2.35A {Gallu 99.94
4eku_A 392 Protein-tyrosine kinase 2-beta; proline-rich tyros 99.89
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 99.75
1wgr_A100 Growth factor receptor-bound protein 7; RA domain, 99.5
4f7g_A 222 Talin-1; alpha-helix bundle, integrin activation, 99.25
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 99.24
4gmv_A 281 RAS-associated and pleckstrin homology domains-CO 98.93
3hk0_A 256 Growth factor receptor-bound protein 10; GRB10, RA 98.62
3tca_A 291 Amyloid beta A4 precursor protein-binding family 1 98.42
2cs4_A95 Protein C12ORF2; GTP binding, ubiquitin fold, stru 98.08
2uwq_A86 Apoptosis-stimulating of P53 protein 2; ASPP2, ubi 98.04
1wxa_A116 Afadin, AF-6 protein; RAS-binding domain, ubiquiti 97.35
3ddc_B163 RAS association domain-containing family protein; 96.95
2c5l_C117 Phosphoinositide-specific phospholipase C PLC-epsi 96.87
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 96.73
1wgy_A104 RAP guanine nucleotide exchange factor 5; ubiquiti 96.1
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 96.06
2dhz_A120 RAP guanine nucleotide exchange factor (GEF)- like 96.01
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 95.66
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 95.57
2bye_A110 Phospholipase C, epsilon 1; RAS association domain 95.44
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 95.42
3v6c_B91 Ubiquitin; structural genomics, structural genomic 95.38
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 95.3
2pjh_A80 Protein NPL4, nuclear protein localization protein 95.28
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 95.28
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 95.13
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 95.11
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 95.08
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 95.04
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 95.01
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 94.91
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 94.88
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 94.88
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 94.73
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 94.71
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 94.7
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 94.5
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 94.49
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 94.46
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 94.45
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 94.43
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 94.42
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 94.37
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 94.36
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 94.28
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 93.93
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 93.91
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 93.74
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 93.56
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 93.47
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 93.46
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 93.42
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 93.41
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 93.29
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 93.21
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 93.07
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 92.9
1we6_A111 Splicing factor, putative; structural genomics, ub 92.9
1c1y_B77 Proto-onkogene serine/threonine protein kinase RAF 92.65
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 92.62
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 92.59
1lfd_A87 Ralgds; RAL, effector interaction; HET: GNP; 2.10A 92.39
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 92.26
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 92.24
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 92.19
1wxm_A86 A-RAF proto-oncogene serine/threonine-protein kina 92.15
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 92.1
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 91.91
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 91.86
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 91.72
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 91.68
1rax_A115 Protein (RA-domain of RAL guanosine dissociation s 91.44
2l05_A95 Serine/threonine-protein kinase B-RAF; structural 91.37
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 91.31
3m62_B106 UV excision repair protein RAD23; armadillo-like r 91.22
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 90.89
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 90.81
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 90.73
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 90.72
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 90.39
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 90.36
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 90.31
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 90.2
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 90.13
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 90.01
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 89.99
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 89.97
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 89.89
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 89.83
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 89.22
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 89.6
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 89.51
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 89.43
3ny5_A96 Serine/threonine-protein kinase B-RAF; NESG, struc 89.37
1vd2_A89 Protein kinase C, IOTA type; PB1 domain, OPCA moti 89.0
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 88.94
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 88.83
1rlf_A90 RLF, RLF-RBD; signal transduction protein; NMR {Mu 88.58
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 88.3
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 88.04
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 87.83
1rrb_A107 RAF-1 RBD, RAF proto-oncogene serine/threonine-pro 87.14
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 86.88
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 86.64
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 86.26
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 86.1
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 86.09
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 86.06
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 85.94
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 85.87
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 85.66
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 85.52
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 85.49
3kh0_A140 Ralgds, ralgef, RAL guanine nucleotide dissociatio 84.32
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 83.89
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 83.37
3epy_A89 Acyl-COA-binding domain-containing protein 7; acyl 83.2
1ef5_A103 RGL; RAS-binding domain, RAS, RBD, RA, riken struc 82.67
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 82.65
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 82.13
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 81.94
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 81.78
2cb8_A87 Acyl-COA-binding protein; acyl-coenzyme A binding 81.52
1ip9_A85 BEM1 protein; ubiquitin alpha/beta roll, signaling 81.16
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 80.96
1q1o_A98 Cell division control protein 24; PB1 domain, PCCR 80.6
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 80.49
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 80.14
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Back     alignment and structure
Probab=99.97  E-value=1.4e-31  Score=242.65  Aligned_cols=154  Identities=19%  Similarity=0.229  Sum_probs=137.0

Q ss_pred             ceeeeeccCCCCCCCCeEEEEEEecCCEEEEEEcCCCCHHHHHHHHHHHhCCCCCCCceeEEEEeCCCCCCcccccCcch
Q psy5112           2 EVLSILLKNPYHHSLPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDKNLEHYLEPEL   81 (184)
Q Consensus         2 e~~~~~~~~p~~~~~pi~~~V~llDg~~~~v~vdsstT~~e~~~~i~~klgL~~~~~~gFsL~~~~~~~~~~~~~l~~~~   81 (184)
                      ||.++..|+      ++.++|+|+||+.+++.+|++||++|+++.||++|||.+ +.++||||....   +.+++|.+++
T Consensus       207 Ei~a~~~~~------~~~~~V~l~dg~~~~~~v~~~tt~~el~~~v~~~lgL~e-~~~~FgL~~~~~---~~~~~L~~~~  276 (555)
T 3au4_A          207 EIEALIHRQ------EMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMED-SRNMFALFEYNG---HVDKAIESRT  276 (555)
T ss_dssp             HHHHHHTTC------CEEEEEEETTSCEEEEEECTTCBHHHHHHHHHHHTTCTT-CCSEEEEEEESS---SCEEECCTTS
T ss_pred             HHHHHHhCC------CcceEEEecCCCeEEEEeCCCCcHHHHHHHHHHHcCCCC-CCCceEEEEEeC---CeeEecCCCC
Confidence            666666666      689999999999999999999999999999999999996 478999999875   6788998888


Q ss_pred             hhccccCCCccceeeeeehhHHHHHHHHHHhCCCcccCCceeEEEEeeeeeecCCCCCCChhhHHhHHHhhhhhhhcCCC
Q psy5112          82 KVSQTKGKYPLKIYVMLCDVISKWETALREKGTGKFENNRCVQFIYKNRLYFRSLSKKETDRERLLLCYQTNQQVVLGRF  161 (184)
Q Consensus        82 k~~~~~~~~~~~~~~~i~D~l~~we~~~~~~~~~~~~~~~~~~l~fr~k~f~~~~~~~~d~~e~~l~y~Q~~~~v~~G~~  161 (184)
                      +               ++|++++||+..++.+.    ...+|+|+||+++|.++....+|+++++|+|.|+++||++|+|
T Consensus       277 ~---------------i~D~~~~we~~~~~~~~----~~~~~~l~fR~~ff~~~~~~~~d~~~~~lly~Q~~~dil~G~~  337 (555)
T 3au4_A          277 V---------------VADVLAKFEKLAATSEV----GDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHH  337 (555)
T ss_dssp             B---------------HHHHHHHHHHHTTSCCT----TCCCCEEEEEEEECSCCTTCCTTSHHHHHHHHHHHHHHHTTCS
T ss_pred             c---------------hhHHHHHHHHHhhccCC----CCCceEEEEEEEeecCcccCCcchHHHHhhHHHHHHHHHCCCC
Confidence            5               99999999998654322    2358999999999988777788999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHhHhhcCCC
Q psy5112         162 PLTKELALELAALLSQVCFKQVG  184 (184)
Q Consensus       162 p~~~e~a~~LAAl~~Q~e~Gd~~  184 (184)
                      ||+.++|++||||++|+++|||+
T Consensus       338 ~~~~e~a~~LAAl~lQ~~~GD~~  360 (555)
T 3au4_A          338 PAPEENLQVLAALRLQYLQGDYT  360 (555)
T ss_dssp             CCCHHHHHHHHHHHHHHHHCSCC
T ss_pred             CCCHHHHHHHHHHHHHHHcCCCc
Confidence            99999999999999999999985
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} PDB: 3u7d_A Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A Back     alignment and structure
>4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>1wgr_A Growth factor receptor-bound protein 7; RA domain, GRB7, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>2cs4_A Protein C12ORF2; GTP binding, ubiquitin fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>2uwq_A Apoptosis-stimulating of P53 protein 2; ASPP2, ubiquitin-like, SH3-domain, cell cycle, ANK repeat, SH3-binding; NMR {Homo sapiens} Back     alignment and structure
>1wxa_A Afadin, AF-6 protein; RAS-binding domain, ubiquitin-like fold, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.15.1.5 Back     alignment and structure
>3ddc_B RAS association domain-containing family protein; oncogene, tumorsuppressor, ubiquitin fold, RAS effector, RAP rassf1, rassf5, RAPL, NORE1, GMPPNP; HET: GNP; 1.80A {Mus musculus} Back     alignment and structure
>2c5l_C Phosphoinositide-specific phospholipase C PLC-epsilon; signaling protein/complex, RAS, ubiquitin superfold, oncogene, GTP-binding; HET: GTP; 1.9A {Homo sapiens} SCOP: d.15.1.5 PDB: 2byf_A Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>1wgy_A RAP guanine nucleotide exchange factor 5; ubiquitin fold, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>2dhz_A RAP guanine nucleotide exchange factor (GEF)- like 1; LINK guanine nucleotide exchange factor II, LINK-gefii, RA domain, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>2bye_A Phospholipase C, epsilon 1; RAS association domain, ubiquitin superfold; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1c1y_B Proto-onkogene serine/threonine protein kinase RAF-1; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: d.15.1.5 PDB: 1gua_B* 1rfa_A 3kud_B* 3kuc_B* Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1lfd_A Ralgds; RAL, effector interaction; HET: GNP; 2.10A {Rattus norvegicus} SCOP: d.15.1.5 PDB: 2b3a_A Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>1wxm_A A-RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain (RBD), ubiquitin-like fold, A-RAF kinase, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1rax_A Protein (RA-domain of RAL guanosine dissociation stimulator); RAS-binding domain, ralgef, ralgds, RAS; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>2l05_A Serine/threonine-protein kinase B-RAF; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>3ny5_A Serine/threonine-protein kinase B-RAF; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics consortium; HET: MSE; 1.99A {Homo sapiens} SCOP: d.15.1.0 Back     alignment and structure
>1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>1rlf_A RLF, RLF-RBD; signal transduction protein; NMR {Mus musculus} SCOP: d.15.1.5 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1rrb_A RAF-1 RBD, RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain, transferase, riken structural genomics/proteomics initiative; NMR {Rattus norvegicus} SCOP: d.15.1.5 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3kh0_A Ralgds, ralgef, RAL guanine nucleotide dissociation stimulator; structural genomics consortium, SGC, RAS-association domain, alternative splicing; 2.10A {Homo sapiens} PDB: 2rgf_A 1lxd_A Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} SCOP: a.11.1.1 Back     alignment and structure
>1ef5_A RGL; RAS-binding domain, RAS, RBD, RA, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Mus musculus} SCOP: d.15.1.5 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A Back     alignment and structure
>1ip9_A BEM1 protein; ubiquitin alpha/beta roll, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 1ipg_A 2kfk_A Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>1q1o_A Cell division control protein 24; PB1 domain, PCCR, PC motif, OPCA motif, yeast, cell polarity, protein-protein interaction; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 2kfj_A 2kfk_B Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 184
d1wgra_100 d.15.1.5 (A:) Growth factor receptor-bound protein 8e-09
d1mixa1114 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus 2e-06
d1h4ra1111 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) 5e-05
d1gg3a1106 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1 6e-05
d1ef1a1111 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [ 7e-05
>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ras-binding domain, RBD
domain: Growth factor receptor-bound protein 7, GRB-7
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 48.7 bits (116), Expect = 8e-09
 Identities = 16/92 (17%), Positives = 24/92 (26%), Gaps = 18/92 (19%)

Query: 17  PHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDKNLEHY 76
           PH + V+  +GA +        T     + L             + L    P    LE  
Sbjct: 9   PHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSDE--TWGLVECHP-HLALERG 65

Query: 77  LEPELKVSQTKGKYPLKIYVMLCDVISKWETA 108
           LE    V                +V + W   
Sbjct: 66  LEDHESV---------------VEVQAAWPVG 82
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 114 Back     information, alignment and structure
>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
d1wgra_100 Growth factor receptor-bound protein 7, GRB-7 {Hum 99.6
d1gg3a1106 Erythroid membrane protein 4.1R {Human (Homo sapie 99.49
d1mixa1114 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 99.48
d1h4ra1111 Merlin {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1ef1a1111 Moesin {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1ef1a384 Moesin {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1gg3a381 Erythroid membrane protein 4.1R {Human (Homo sapie 99.26
d1h4ra384 Merlin {Human (Homo sapiens) [TaxId: 9606]} 99.15
d2al6a1123 Focal adhesion kinase 1 {Chicken (Gallus gallus) [ 99.14
d1wxaa1103 Afadin {Mouse (Mus musculus) [TaxId: 10090]} 98.27
d2cs4a184 Ras association domain-containing protein 8 {Human 98.07
d1wxma173 A-Raf proto-oncogene serine/threonine-protein kina 97.11
d2al6a3100 Focal adhesion kinase 1 {Chicken (Gallus gallus) [ 96.9
d1wgya_104 Rap guanine nucleotide exchange factor 5, RapGEF5 96.77
d1c1yb_77 c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} 96.68
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 96.33
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 95.88
d2byea1109 Phospholipase C-epsilon-1 {Human (Homo sapiens) [T 95.81
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 95.73
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 95.57
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 95.38
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 95.31
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 95.13
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 95.09
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 94.82
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 94.71
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 94.62
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 94.51
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 94.43
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 94.38
d1k8rb_95 Protein kinase byr2 {Fission yeast (Schizosaccharo 94.28
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 94.09
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 93.53
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 93.45
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 93.22
d2c5lc1106 Phospholipase C-epsilon-1 {Human (Homo sapiens) [T 93.09
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 93.0
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 92.92
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 92.92
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 92.83
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 92.63
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 92.37
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 91.88
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 91.84
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 91.43
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 91.35
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 91.25
d1tkea162 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 90.82
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 90.62
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 89.99
d1ip9a_85 Bud emergence mediator Bemp1 {Baker's yeast (Sacch 89.23
d1rlfa_90 RalGDS-like factor, Rlf {Mouse (Mus musculus) [Tax 88.48
d2bkfa185 Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Hum 88.13
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 87.84
d1lfda_87 Ral guanosine-nucleotide exchange factor, RalGDS { 87.76
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 87.48
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 87.47
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 86.71
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 83.94
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 83.62
d1hb6a_86 Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 83.22
d1nyra259 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 82.97
d2npta1105 Mitogen activated protein kinase kinase 5, Map2k5 81.91
>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ras-binding domain, RBD
domain: Growth factor receptor-bound protein 7, GRB-7
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.60  E-value=1e-15  Score=108.27  Aligned_cols=91  Identities=18%  Similarity=0.259  Sum_probs=76.8

Q ss_pred             CCCCeEEEEEEecCCEEEEEEcCCCCHHHHHHHHHHHhCCCCCCCceeEEEEeCCCCCCcccccCcchhhccccCCCccc
Q psy5112          14 HSLPHSIPVHLLNGAYQVTGFDGSTTIEEFLQTLNSEIDCRDSNVSGFALFSDDPIDKNLEHYLEPELKVSQTKGKYPLK   93 (184)
Q Consensus        14 ~~~pi~~~V~llDg~~~~v~vdsstT~~e~~~~i~~klgL~~~~~~gFsL~~~~~~~~~~~~~l~~~~k~~~~~~~~~~~   93 (184)
                      -..|++++||++||+++++.||++||++|+++.+++|+++.  +...|+||+..+. .+.+|.|.+.++           
T Consensus         6 ~~~~~vvkv~~~dg~~k~l~V~~~tTa~eV~~~l~~K~~~~--~~~~f~L~E~~~~-~~leR~L~d~E~-----------   71 (100)
T d1wgra_           6 SGRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHAL--SDETWGLVECHPH-LALERGLEDHES-----------   71 (100)
T ss_dssp             CCSCEEEEEEETTSCEEEEEECTTCCHHHHHHHHHCSSSCC--CCCCCCEEEEETT-TTEEEEECSSSC-----------
T ss_pred             CCCceEEEEEecCCCEEEEEECCCCcHHHHHHHHHHHhCCC--CCCCeEEEEecCC-CcceeecCchHh-----------
Confidence            34799999999999999999999999999999999999998  5568999999872 246799999997           


Q ss_pred             eeeeeehhHHHHHHHHHHhCCCcccCCceeEEEEeeeeeec
Q psy5112          94 IYVMLCDVISKWETALREKGTGKFENNRCVQFIYKNRLYFR  134 (184)
Q Consensus        94 ~~~~i~D~l~~we~~~~~~~~~~~~~~~~~~l~fr~k~f~~  134 (184)
                          ++|++..|..            ..+.+|+||+.+...
T Consensus        72 ----vl~v~~~W~~------------~~~~r~v~rknya~~   96 (100)
T d1wgra_          72 ----VVEVQAAWPV------------GGDSRFVFRKNFASG   96 (100)
T ss_dssp             ----HHHHHTTSCS------------SSCCEEEECSCCSSS
T ss_pred             ----HHHHHHcCCC------------CCCCEEEEeecCCCC
Confidence                9999999942            124589999885443
>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wxaa1 d.15.1.5 (A:8-110) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cs4a1 d.15.1.5 (A:8-91) Ras association domain-containing protein 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2al6a3 d.15.1.4 (A:31-130) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wgya_ d.15.1.5 (A:) Rap guanine nucleotide exchange factor 5, RapGEF5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1yb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2byea1 d.15.1.5 (A:2-110) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8rb_ d.15.1.5 (B:) Protein kinase byr2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5lc1 d.15.1.5 (C:2134-2239) Phospholipase C-epsilon-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rlfa_ d.15.1.5 (A:) RalGDS-like factor, Rlf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bkfa1 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfda_ d.15.1.5 (A:) Ral guanosine-nucleotide exchange factor, RalGDS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nyra2 d.15.10.1 (A:4-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2npta1 d.15.2.2 (A:4-108) Mitogen activated protein kinase kinase 5, Map2k5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure