Diaphorina citri psyllid: psy5116

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420--

MYGRIKRRGRPPKTPNTERPKFQVHLLKKPQYLQNLEARGLNSPITSRTSSPQGSETSRRSTAKKGTKRKSNPPTRGGRGGNQKRKQTLETDYHYGSDFEDSTDHDDDLGLSESETEPEKDDPLDEMSDSDLSLSSFSTTSGTNKKFSYISRMSPEPLWLQTERQIQPLELPRSSDDLLIPREYVMQTLSIYEVLRHFKSLIRLSPFRFEDFCAVLNFEEQSNLLVEIHVSLLKTIFREEDTQQTHFGPLDQKDSANSVLYFIDAMTWPEALRSYIESDKTFDEEVLNILNTCEYPFTNIEKRLRVLQFLTDQILITSPVREDLIHEGGFQYDDHCRVCHRVGELLCCETCPAVFHLECVDPPLRDVPQEDWQCNLCKAHKVTGVTDCLPDVEKSGLLCRQEHLGFDRAGRKYWFLSRRIFM

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHcccHHHHHHHHHHcccccHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccCEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEc

**************************************************************************************************************************************************************WL***RQ****ELPRSSDDLLIPREYVMQTLSIYEVLRHFKSLIRLSPFRFEDFCAVLNFEEQSNLLVEIHVSLLKTIFREEDT**THFG*****DSANSVLYFIDAMTWPEALRSYIESDKTFDEEVLNILNTCEYPFTNIEKRLRVLQFLTDQILITSPVREDLIHEGGFQYDDHCRVCHRVGELLCCETCPAVFHLECVDPPLRDVPQEDWQCNLCKAHKVTGVTDCLP***KSGLLCRQEHLGFDRAGRKYWFLSRRIFM

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0006338 [BP]	chromatin remodeling	probable	GO:0006996, GO:0051276, GO:0006325, GO:0071840, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0016568
GO:0008134 [MF]	transcription factor binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0008094 [MF]	DNA-dependent ATPase activity	probable	GO:0016787, GO:0016818, GO:0042623, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0016887
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016589 [CC]	NURF complex	probable	GO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0031010, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0070603, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YSM, chain A
Confidence level:very confident
Coverage over the Query: 330-417
View the alignment between query and template
View the model in PyMOL