Diaphorina citri psyllid: psy5125


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MSIISHMKVHLSLSRNLSLLCVQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPANVDVAMELLYNWVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP
ccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHccccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHccEEEEEEEccccccccEEEECcccccHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccccc
**I*SHMKVHLSLSRNLSLLCVQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPANVDVAMELLYNWVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPAL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIISHMKVHLSLSRNLSLLCVQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPANVDVAMELLYNWVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dihydropteridine reductase The product of this enzyme, tetrahydrobiopterin (BH-4), is an essential cofactor for phenylalanine, tyrosine, and tryptophan hydroxylases.confidentQ8MJ30
Dihydropteridine reductase The product of this enzyme, tetrahydrobiopterin (BH-4), is an essential cofactor for phenylalanine, tyrosine, and tryptophan hydroxylases.confidentQ3T0Z7
Dihydropteridine reductase The product of this enzyme, tetrahydrobiopterin (BH-4), is an essential cofactor for phenylalanine, tyrosine, and tryptophan hydroxylases.confidentP09417

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OOE, chain A
Confidence level:very confident
Coverage over the Query: 88-210
View the alignment between query and template
View the model in PyMOL
Template: 1OOE, chain A
Confidence level:very confident
Coverage over the Query: 13-118
View the alignment between query and template
View the model in PyMOL