Psyllid ID: psy5125


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MSIISHMKVHLSLSRNLSLLCVQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPANVDVAMELLYNWVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP
ccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHccccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHccEEEEEEEccccccccEEEEEcccccHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccccc
cEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEccHHHHcccccEHHHHHHHHHcEEEEEEccccccccEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEEcccccccEccccccHHHHHHHHHHHcHHHHHHHHHHHHHHEEEEEEEEEEccHHHHcccc
MSIISHMKVHLSLSRNLSLLCVQETTVLAELKTILAGDKIDAVICVaggwaggnaaaKDFVKSADIMWRQSVWSSVLAATIAAnhlkpgglvslpgakpalegtpanVDVAMELLYNWVgsidlnpndqadaniivnkddawLEQETTVLAELKTILAGDKIDAVICVaggwaggnaaaKDFVKSADIMWRQSVWSSVLAATIAAnhlkpgglvslpgakpalegtp
MSIISHMKVHLSLSRNLSLLCVQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPANVDVAMELLYNWVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANhlkpgglvslpgakpalegtp
MSIISHMKVHLSLSRNLSLLCVQETTVLAELKTILAGDKIDAVICVaggwaggnaaaKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPANVDVAMELLYNWVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVaggwaggnaaaKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP
*****HMKVHLSLSRNLSLLCVQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPANVDVAMELLYNWVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLV*************
**I*SHMKVHLSLSRNL****************ILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPANVDVAMELLYNWVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPAL****
MSIISHMKVHLSLSRNLSLLCVQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPANVDVAMELLYNWVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP
MSIISHMKVHLSLSRNLSLLCVQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPANVDVAMELLYNWVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPAL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIISHMKVHLSLSRNLSLLCVQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPANVDVAMELLYNWVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query227 2.2.26 [Sep-21-2011]
Q3T0Z7242 Dihydropteridine reductas yes N/A 0.484 0.454 0.509 3e-29
Q8MJ30243 Dihydropteridine reductas yes N/A 0.484 0.452 0.509 9e-29
P09417244 Dihydropteridine reductas yes N/A 0.484 0.450 0.509 2e-28
P11348241 Dihydropteridine reductas yes N/A 0.484 0.456 0.509 3e-28
Q8BVI4241 Dihydropteridine reductas yes N/A 0.484 0.456 0.490 3e-27
Q86A17231 Dihydropteridine reductas yes N/A 0.440 0.432 0.370 4e-10
>sp|Q3T0Z7|DHPR_BOVIN Dihydropteridine reductase OS=Bos taurus GN=QDPR PE=2 SV=1 Back     alignment and function desciption
 Score =  128 bits (322), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 56/110 (50%), Positives = 82/110 (74%)

Query: 118 WVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNA 177
           WV SID+  N++A AN++V   D++ EQ   V AE+  +L  +K+DA++CVAGGWAGGNA
Sbjct: 34  WVASIDVQENEEASANVVVKMTDSFTEQADQVTAEVGKLLGTEKVDAILCVAGGWAGGNA 93

Query: 178 AAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP 227
            +K   K+ D+MW+QSVW+S +++ +A  HLK GGL++L GA+ AL+GTP
Sbjct: 94  KSKSLFKNCDLMWKQSVWTSTISSHLATKHLKEGGLLTLAGARAALDGTP 143




The product of this enzyme, tetrahydrobiopterin (BH-4), is an essential cofactor for phenylalanine, tyrosine, and tryptophan hydroxylases.
Bos taurus (taxid: 9913)
EC: 1EC: .EC: 5EC: .EC: 1EC: .EC: 3EC: 4
>sp|Q8MJ30|DHPR_PIG Dihydropteridine reductase OS=Sus scrofa GN=QDPR PE=2 SV=1 Back     alignment and function description
>sp|P09417|DHPR_HUMAN Dihydropteridine reductase OS=Homo sapiens GN=QDPR PE=1 SV=2 Back     alignment and function description
>sp|P11348|DHPR_RAT Dihydropteridine reductase OS=Rattus norvegicus GN=Qdpr PE=1 SV=1 Back     alignment and function description
>sp|Q8BVI4|DHPR_MOUSE Dihydropteridine reductase OS=Mus musculus GN=Qdpr PE=1 SV=2 Back     alignment and function description
>sp|Q86A17|DHPR_DICDI Dihydropteridine reductase OS=Dictyostelium discoideum GN=qdpr PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query227
312375153234 hypothetical protein AND_14502 [Anophele 0.480 0.465 0.645 6e-34
289740315235 reductases [Glossina morsitans morsitans 0.480 0.463 0.636 6e-34
195135535235 GI16833 [Drosophila mojavensis] gi|19391 0.480 0.463 0.654 7e-34
289724616210 dihydropteridine reductase dHPR/QdPR [Gl 0.480 0.519 0.636 1e-33
195375020235 GJ12582 [Drosophila virilis] gi|19415345 0.590 0.570 0.586 1e-33
383866338237 PREDICTED: dihydropteridine reductase-li 0.484 0.464 0.609 2e-33
347968029233 AGAP002534-PB [Anopheles gambiae str. PE 0.480 0.467 0.645 2e-33
58383114234 AGAP002534-PA [Anopheles gambiae str. PE 0.480 0.465 0.645 2e-33
125980289235 GA18340 [Drosophila pseudoobscura pseudo 0.480 0.463 0.636 3e-33
195490952235 GE20807 [Drosophila yakuba] gi|194179458 0.480 0.463 0.636 5e-33
>gi|312375153|gb|EFR22576.1| hypothetical protein AND_14502 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  149 bits (377), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 71/110 (64%), Positives = 90/110 (81%), Gaps = 1/110 (0%)

Query: 118 WVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNA 177
           WVGSIDL  ND ADANI+V++D  W+ QE+ VL++++  L GD +DA+ICVAGGWAGGN 
Sbjct: 29  WVGSIDLTENDAADANIVVDRDADWIAQESAVLSKVEAELKGDSLDAIICVAGGWAGGN- 87

Query: 178 AAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP 227
           A KD  K+AD+MW+QSVWSS ++AT+ ANHLKPGG++ L GA PALEGTP
Sbjct: 88  AKKDLAKNADLMWKQSVWSSAISATVGANHLKPGGVLVLTGANPALEGTP 137




Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|289740315|gb|ADD18905.1| reductases [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|195135535|ref|XP_002012188.1| GI16833 [Drosophila mojavensis] gi|193918452|gb|EDW17319.1| GI16833 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|289724616|gb|ADD18291.1| dihydropteridine reductase dHPR/QdPR [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|195375020|ref|XP_002046301.1| GJ12582 [Drosophila virilis] gi|194153459|gb|EDW68643.1| GJ12582 [Drosophila virilis] Back     alignment and taxonomy information
>gi|383866338|ref|XP_003708627.1| PREDICTED: dihydropteridine reductase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|347968029|ref|XP_003436147.1| AGAP002534-PB [Anopheles gambiae str. PEST] gi|333468196|gb|EGK96866.1| AGAP002534-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|58383114|ref|XP_312404.2| AGAP002534-PA [Anopheles gambiae str. PEST] gi|55242231|gb|EAA07501.3| AGAP002534-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|125980289|ref|XP_001354169.1| GA18340 [Drosophila pseudoobscura pseudoobscura] gi|195174538|ref|XP_002028030.1| GL15041 [Drosophila persimilis] gi|54642473|gb|EAL31221.1| GA18340 [Drosophila pseudoobscura pseudoobscura] gi|194115752|gb|EDW37795.1| GL15041 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195490952|ref|XP_002093357.1| GE20807 [Drosophila yakuba] gi|194179458|gb|EDW93069.1| GE20807 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query227
FB|FBgn0035964235 Dhpr "Dihydropteridine reducta 0.590 0.570 0.514 4.4e-29
WB|WBGene00011398236 qdpr-1 [Caenorhabditis elegans 0.594 0.572 0.449 6.8e-24
UNIPROTKB|Q3T0Z7242 QDPR "Dihydropteridine reducta 0.484 0.454 0.427 2.9e-23
UNIPROTKB|I3LKS6243 QDPR "Dihydropteridine reducta 0.484 0.452 0.427 3.8e-23
UNIPROTKB|Q8MJ30243 QDPR "Dihydropteridine reducta 0.484 0.452 0.427 6.1e-23
UNIPROTKB|P09417244 QDPR "Dihydropteridine reducta 0.484 0.450 0.427 1e-22
UNIPROTKB|B7Z415152 QDPR "Quinoid dihydropteridine 0.484 0.723 0.427 1e-22
UNIPROTKB|D6RGG7162 QDPR "Dihydropteridine reducta 0.484 0.679 0.427 1e-22
UNIPROTKB|H0Y8F7128 QDPR "Dihydropteridine reducta 0.484 0.859 0.427 1e-22
RGD|619915241 Qdpr "quinoid dihydropteridine 0.484 0.456 0.427 1.3e-22
FB|FBgn0035964 Dhpr "Dihydropteridine reductase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 323 (118.8 bits), Expect = 4.4e-29, P = 4.4e-29
 Identities = 71/138 (51%), Positives = 95/138 (68%)

Query:    90 GLVSLPGAKPALEGTPANVDVAMELLYNWVGSIDLNPNDQADANIIVNKDDAWLEQETTV 149
             G V + G K AL G+ A VD      Y WVGSIDL  N++AD +I+V +D +W+EQE TV
Sbjct:     4 GRVVIYGGKGAL-GS-ACVDHFKANNY-WVGSIDLTENEKADVSIVVPRDASWVEQEETV 60

Query:   150 LAELKTILAGDKIDAVICVXXXXXXXXXXXKDFVKSADIMWRQSVWSSVLAATIAANHLK 209
             ++++   LAG+K+DAVICV           KD  K+AD+MW+QSV +S ++A +AA HLK
Sbjct:    61 VSKVGESLAGEKLDAVICVAGGWAGGNAK-KDLAKNADLMWKQSVLTSAISAAVAAQHLK 119

Query:   210 PGGLVSLPGAKPALEGTP 227
              GGL++L GAKPALEGTP
Sbjct:   120 AGGLLALTGAKPALEGTP 137


GO:0004155 "6,7-dihydropteridine reductase activity" evidence=ISS;NAS
GO:0008152 "metabolic process" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
WB|WBGene00011398 qdpr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0Z7 QDPR "Dihydropteridine reductase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LKS6 QDPR "Dihydropteridine reductase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MJ30 QDPR "Dihydropteridine reductase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P09417 QDPR "Dihydropteridine reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z415 QDPR "Quinoid dihydropteridine reductase, isoform CRA_c" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D6RGG7 QDPR "Dihydropteridine reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y8F7 QDPR "Dihydropteridine reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|619915 Qdpr "quinoid dihydropteridine reductase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3T0Z7DHPR_BOVIN1, ., 5, ., 1, ., 3, 40.50900.48450.4545yesN/A
P11348DHPR_RAT1, ., 5, ., 1, ., 3, 40.50900.48450.4564yesN/A
P09417DHPR_HUMAN1, ., 5, ., 1, ., 3, 40.50900.48450.4508yesN/A
Q8MJ30DHPR_PIG1, ., 5, ., 1, ., 3, 40.50900.48450.4526yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.5.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query227
cd05334221 cd05334, DHPR_SDR_c_like, dihydropteridine reducta 2e-37
cd05334221 cd05334, DHPR_SDR_c_like, dihydropteridine reducta 2e-25
>gnl|CDD|187595 cd05334, DHPR_SDR_c_like, dihydropteridine reductase (DHPR), classical (c) SDRs Back     alignment and domain information
 Score =  129 bits (327), Expect = 2e-37
 Identities = 58/110 (52%), Positives = 80/110 (72%), Gaps = 2/110 (1%)

Query: 118 WVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNA 177
           WV SIDL  N++ADA+IIV   D++ EQ   V+A +  +    K+DA+ICVAGGWAGG+A
Sbjct: 27  WVASIDLAENEEADASIIVLDSDSFTEQAKQVVASVARL--SGKVDALICVAGGWAGGSA 84

Query: 178 AAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP 227
            +K FVK+ D+MW+Q++W+S +A+ +A  HL  GGL+ L GAK ALE TP
Sbjct: 85  KSKSFVKNWDLMWKQNLWTSFIASHLATKHLLSGGLLVLTGAKAALEPTP 134


Dihydropteridine reductase is an NAD-binding protein related to the SDRs. It converts dihydrobiopterin into tetrahydrobiopterin, a cofactor necessary in catecholamines synthesis. Dihydropteridine reductase has the YXXXK of these tyrosine-dependent oxidoreductases, but lacks the typical upstream Asn and Ser catalytic residues. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs. Length = 221

>gnl|CDD|187595 cd05334, DHPR_SDR_c_like, dihydropteridine reductase (DHPR), classical (c) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 227
KOG4022|consensus236 100.0
KOG4022|consensus236 99.94
PRK06484 520 short chain dehydrogenase; Validated 99.79
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.76
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 99.7
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 99.66
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 99.66
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.65
PRK08339 263 short chain dehydrogenase; Provisional 99.65
PRK06398 258 aldose dehydrogenase; Validated 99.65
PRK12747252 short chain dehydrogenase; Provisional 99.64
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.63
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.63
PRK08589 272 short chain dehydrogenase; Validated 99.63
PRK07063 260 short chain dehydrogenase; Provisional 99.63
PRK06603 260 enoyl-(acyl carrier protein) reductase; Provisiona 99.63
PRK06128300 oxidoreductase; Provisional 99.63
PRK08594 257 enoyl-(acyl carrier protein) reductase; Provisiona 99.63
PRK08159 272 enoyl-(acyl carrier protein) reductase; Provisiona 99.62
PRK07985294 oxidoreductase; Provisional 99.62
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.62
PRK06997 260 enoyl-(acyl carrier protein) reductase; Provisiona 99.62
PRK07370 258 enoyl-(acyl carrier protein) reductase; Validated 99.62
PRK06179 270 short chain dehydrogenase; Provisional 99.62
PRK05872 296 short chain dehydrogenase; Provisional 99.62
PRK06523 260 short chain dehydrogenase; Provisional 99.61
PRK07062 265 short chain dehydrogenase; Provisional 99.6
PRK07791 286 short chain dehydrogenase; Provisional 99.6
PRK07890 258 short chain dehydrogenase; Provisional 99.59
PRK07856 252 short chain dehydrogenase; Provisional 99.58
PRK06114 254 short chain dehydrogenase; Provisional 99.58
PRK08303 305 short chain dehydrogenase; Provisional 99.58
COG0300 265 DltE Short-chain dehydrogenases of various substra 99.58
PRK08265 261 short chain dehydrogenase; Provisional 99.58
KOG1205|consensus 282 99.58
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.57
PRK05876 275 short chain dehydrogenase; Provisional 99.57
PRK08690 261 enoyl-(acyl carrier protein) reductase; Provisiona 99.57
PRK07576 264 short chain dehydrogenase; Provisional 99.57
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 99.57
PRK06172 253 short chain dehydrogenase; Provisional 99.57
PRK07889 256 enoyl-(acyl carrier protein) reductase; Provisiona 99.56
PRK12937245 short chain dehydrogenase; Provisional 99.56
PRK06483236 dihydromonapterin reductase; Provisional 99.56
PRK05717 255 oxidoreductase; Validated 99.56
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 99.56
PRK07825 273 short chain dehydrogenase; Provisional 99.56
PRK07677 252 short chain dehydrogenase; Provisional 99.56
PRK07067 257 sorbitol dehydrogenase; Provisional 99.56
PRK06139 330 short chain dehydrogenase; Provisional 99.56
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.55
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.55
PRK06180 277 short chain dehydrogenase; Provisional 99.55
PLN02253 280 xanthoxin dehydrogenase 99.55
PRK07478 254 short chain dehydrogenase; Provisional 99.54
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 99.54
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.54
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.54
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.54
PRK09242 257 tropinone reductase; Provisional 99.54
PRK06194 287 hypothetical protein; Provisional 99.54
PRK07814 263 short chain dehydrogenase; Provisional 99.54
PRK06500 249 short chain dehydrogenase; Provisional 99.54
PRK05867253 short chain dehydrogenase; Provisional 99.53
PRK08643 256 acetoin reductase; Validated 99.53
PRK07523 255 gluconate 5-dehydrogenase; Provisional 99.53
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.53
PRK06701290 short chain dehydrogenase; Provisional 99.53
PRK05993 277 short chain dehydrogenase; Provisional 99.52
PRK06124 256 gluconate 5-dehydrogenase; Provisional 99.52
PRK06182 273 short chain dehydrogenase; Validated 99.52
PRK08263 275 short chain dehydrogenase; Provisional 99.52
PRK07831262 short chain dehydrogenase; Provisional 99.51
PRK12743 256 oxidoreductase; Provisional 99.51
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 99.51
PRK07024 257 short chain dehydrogenase; Provisional 99.51
PRK07109 334 short chain dehydrogenase; Provisional 99.51
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.51
PRK07035252 short chain dehydrogenase; Provisional 99.51
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.51
PRK08278 273 short chain dehydrogenase; Provisional 99.51
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.51
PRK08085 254 gluconate 5-dehydrogenase; Provisional 99.51
PRK08862227 short chain dehydrogenase; Provisional 99.51
PRK06841255 short chain dehydrogenase; Provisional 99.51
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.51
PRK07097 265 gluconate 5-dehydrogenase; Provisional 99.5
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 99.5
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.5
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 99.49
PRK05855 582 short chain dehydrogenase; Validated 99.49
PRK08277 278 D-mannonate oxidoreductase; Provisional 99.49
PRK09186 256 flagellin modification protein A; Provisional 99.49
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.49
PRK08628 258 short chain dehydrogenase; Provisional 99.49
PRK08936 261 glucose-1-dehydrogenase; Provisional 99.49
PRK12744 257 short chain dehydrogenase; Provisional 99.49
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.48
PRK09134 258 short chain dehydrogenase; Provisional 99.48
PRK05650 270 short chain dehydrogenase; Provisional 99.48
PRK07832 272 short chain dehydrogenase; Provisional 99.48
PRK05693 274 short chain dehydrogenase; Provisional 99.48
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.47
PRK05875 276 short chain dehydrogenase; Provisional 99.47
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 99.47
PRK06057 255 short chain dehydrogenase; Provisional 99.47
PRK08340 259 glucose-1-dehydrogenase; Provisional 99.47
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.47
PRK06484 520 short chain dehydrogenase; Validated 99.47
PRK08267 260 short chain dehydrogenase; Provisional 99.47
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 99.47
PRK12939250 short chain dehydrogenase; Provisional 99.47
PRK06123248 short chain dehydrogenase; Provisional 99.46
PRK06125 259 short chain dehydrogenase; Provisional 99.46
PRK10538 248 malonic semialdehyde reductase; Provisional 99.46
PRK06077 252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.46
PRK12746254 short chain dehydrogenase; Provisional 99.46
PRK07454241 short chain dehydrogenase; Provisional 99.46
PRK07774250 short chain dehydrogenase; Provisional 99.45
PRK08226 263 short chain dehydrogenase; Provisional 99.45
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.45
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.45
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.45
PRK06198 260 short chain dehydrogenase; Provisional 99.45
PRK06482 276 short chain dehydrogenase; Provisional 99.44
PRK07069 251 short chain dehydrogenase; Validated 99.44
PRK06914 280 short chain dehydrogenase; Provisional 99.44
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.44
PRK06113 255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.44
PRK12742237 oxidoreductase; Provisional 99.44
PRK07453 322 protochlorophyllide oxidoreductase; Validated 99.44
PRK06138 252 short chain dehydrogenase; Provisional 99.43
PRK06949258 short chain dehydrogenase; Provisional 99.43
PRK06947248 glucose-1-dehydrogenase; Provisional 99.43
PRK05884223 short chain dehydrogenase; Provisional 99.42
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.42
PRK08703239 short chain dehydrogenase; Provisional 99.42
TIGR02415 254 23BDH acetoin reductases. One member of this famil 99.42
PRK07578199 short chain dehydrogenase; Provisional 99.42
PLN00015 308 protochlorophyllide reductase 99.42
PRK07326237 short chain dehydrogenase; Provisional 99.42
PRK05866 293 short chain dehydrogenase; Provisional 99.42
PRK12829 264 short chain dehydrogenase; Provisional 99.41
PRK09072 263 short chain dehydrogenase; Provisional 99.41
PRK07023243 short chain dehydrogenase; Provisional 99.41
PRK06181 263 short chain dehydrogenase; Provisional 99.41
PRK05854 313 short chain dehydrogenase; Provisional 99.4
KOG1201|consensus 300 99.4
PRK07577234 short chain dehydrogenase; Provisional 99.4
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.4
PRK08213 259 gluconate 5-dehydrogenase; Provisional 99.4
PRK12828239 short chain dehydrogenase; Provisional 99.39
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.39
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.39
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.39
KOG0725|consensus 270 99.38
PRK12745 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.38
PRK07102243 short chain dehydrogenase; Provisional 99.38
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.37
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.37
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.36
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.36
PRK12827249 short chain dehydrogenase; Provisional 99.36
PRK07775 274 short chain dehydrogenase; Provisional 99.36
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 99.36
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.36
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.36
PRK07060245 short chain dehydrogenase; Provisional 99.36
PRK06101 240 short chain dehydrogenase; Provisional 99.35
PRK09135249 pteridine reductase; Provisional 99.35
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.35
PRK08251248 short chain dehydrogenase; Provisional 99.34
PLN02780 320 ketoreductase/ oxidoreductase 99.34
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.34
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.33
PRK06196 315 oxidoreductase; Provisional 99.33
COG1028251 FabG Dehydrogenases with different specificities ( 99.33
PRK06197 306 short chain dehydrogenase; Provisional 99.32
PRK06924 251 short chain dehydrogenase; Provisional 99.32
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.32
PRK06953222 short chain dehydrogenase; Provisional 99.32
PRK07201 657 short chain dehydrogenase; Provisional 99.32
PRK08264238 short chain dehydrogenase; Validated 99.32
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.32
PRK07041230 short chain dehydrogenase; Provisional 99.31
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.31
PRK08324 681 short chain dehydrogenase; Validated 99.31
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.31
PRK05599 246 hypothetical protein; Provisional 99.31
PRK07074 257 short chain dehydrogenase; Provisional 99.27
PRK08177225 short chain dehydrogenase; Provisional 99.27
PRK12367 245 short chain dehydrogenase; Provisional 99.26
PRK06940 275 short chain dehydrogenase; Provisional 99.24
PRK07904253 short chain dehydrogenase; Provisional 99.23
PRK06720169 hypothetical protein; Provisional 99.23
PRK08017 256 oxidoreductase; Provisional 99.22
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.22
PRK09291 257 short chain dehydrogenase; Provisional 99.21
PRK09009235 C factor cell-cell signaling protein; Provisional 99.21
PRK07806 248 short chain dehydrogenase; Provisional 99.2
PRK08219227 short chain dehydrogenase; Provisional 99.19
KOG4169|consensus 261 99.18
KOG1200|consensus256 99.14
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.11
KOG1610|consensus 322 99.1
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.09
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.07
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.06
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.04
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.03
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.03
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.02
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.01
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.01
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.0
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 99.0
PRK12747252 short chain dehydrogenase; Provisional 99.0
PRK08339263 short chain dehydrogenase; Provisional 98.99
PLN02730303 enoyl-[acyl-carrier-protein] reductase 98.96
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 98.96
KOG1210|consensus 331 98.96
PRK06128300 oxidoreductase; Provisional 98.95
PRK05872296 short chain dehydrogenase; Provisional 98.91
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 98.91
PRK07985294 oxidoreductase; Provisional 98.91
PRK07791286 short chain dehydrogenase; Provisional 98.89
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 98.88
PRK06398258 aldose dehydrogenase; Validated 98.88
PRK07063260 short chain dehydrogenase; Provisional 98.88
KOG1208|consensus 314 98.87
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 98.87
KOG1209|consensus 289 98.85
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 98.85
PRK07062265 short chain dehydrogenase; Provisional 98.85
PRK08589272 short chain dehydrogenase; Validated 98.84
KOG1205|consensus282 98.84
PRK06139330 short chain dehydrogenase; Provisional 98.83
PRK12428 241 3-alpha-hydroxysteroid dehydrogenase; Provisional 98.82
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 98.81
PRK07825273 short chain dehydrogenase; Provisional 98.79
PRK07677252 short chain dehydrogenase; Provisional 98.79
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.79
PRK07576264 short chain dehydrogenase; Provisional 98.79
PRK06483236 dihydromonapterin reductase; Provisional 98.78
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.78
PRK05876275 short chain dehydrogenase; Provisional 98.78
PRK06179270 short chain dehydrogenase; Provisional 98.77
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 98.77
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 98.75
PRK12937245 short chain dehydrogenase; Provisional 98.75
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.74
PRK08265261 short chain dehydrogenase; Provisional 98.72
PRK12743256 oxidoreductase; Provisional 98.72
PRK06172253 short chain dehydrogenase; Provisional 98.71
PRK06194287 hypothetical protein; Provisional 98.71
PRK07856252 short chain dehydrogenase; Provisional 98.71
KOG1199|consensus260 98.71
PRK06500249 short chain dehydrogenase; Provisional 98.7
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.7
PRK05855582 short chain dehydrogenase; Validated 98.7
PRK07832272 short chain dehydrogenase; Provisional 98.69
PRK09242257 tropinone reductase; Provisional 98.69
PRK07578199 short chain dehydrogenase; Provisional 98.68
PRK08303305 short chain dehydrogenase; Provisional 98.68
PRK12824245 acetoacetyl-CoA reductase; Provisional 98.68
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 98.68
PRK12744257 short chain dehydrogenase; Provisional 98.67
COG0300265 DltE Short-chain dehydrogenases of various substra 98.67
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 98.67
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 98.67
PRK06701290 short chain dehydrogenase; Provisional 98.67
PRK05693274 short chain dehydrogenase; Provisional 98.67
PRK05867253 short chain dehydrogenase; Provisional 98.67
PRK08278273 short chain dehydrogenase; Provisional 98.66
COG1028251 FabG Dehydrogenases with different specificities ( 98.64
PRK08643256 acetoin reductase; Validated 98.64
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 98.64
PRK07109334 short chain dehydrogenase; Provisional 98.63
PRK08263275 short chain dehydrogenase; Provisional 98.63
PRK12935247 acetoacetyl-CoA reductase; Provisional 98.63
PRK05650270 short chain dehydrogenase; Provisional 98.63
PRK05717255 oxidoreductase; Validated 98.62
PRK07478254 short chain dehydrogenase; Provisional 98.62
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 98.62
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 98.62
PRK07069251 short chain dehydrogenase; Validated 98.62
PRK09134258 short chain dehydrogenase; Provisional 98.62
PRK06180277 short chain dehydrogenase; Provisional 98.62
PRK06182273 short chain dehydrogenase; Validated 98.62
PRK08277278 D-mannonate oxidoreductase; Provisional 98.61
KOG1611|consensus249 98.61
PRK07067257 sorbitol dehydrogenase; Provisional 98.61
PRK07814263 short chain dehydrogenase; Provisional 98.61
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.61
PRK07831262 short chain dehydrogenase; Provisional 98.6
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 98.59
PRK06124256 gluconate 5-dehydrogenase; Provisional 98.59
PRK06841255 short chain dehydrogenase; Provisional 98.59
KOG1204|consensus253 98.59
KOG1014|consensus 312 98.59
PRK06482276 short chain dehydrogenase; Provisional 98.59
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 98.59
PRK07890258 short chain dehydrogenase; Provisional 98.59
PRK06523260 short chain dehydrogenase; Provisional 98.58
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.58
PRK06949258 short chain dehydrogenase; Provisional 98.58
PRK07097265 gluconate 5-dehydrogenase; Provisional 98.58
PRK06114254 short chain dehydrogenase; Provisional 98.58
TIGR02415254 23BDH acetoin reductases. One member of this famil 98.57
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 98.57
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 98.57
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 98.57
PRK12746254 short chain dehydrogenase; Provisional 98.57
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 98.57
KOG1207|consensus245 98.56
PRK07024257 short chain dehydrogenase; Provisional 98.56
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.56
PLN03209 576 translocon at the inner envelope of chloroplast su 98.55
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 98.55
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 98.54
PRK08936261 glucose-1-dehydrogenase; Provisional 98.54
PRK08862227 short chain dehydrogenase; Provisional 98.54
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 98.53
PRK07523255 gluconate 5-dehydrogenase; Provisional 98.53
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 98.53
PRK07454241 short chain dehydrogenase; Provisional 98.53
PRK05993277 short chain dehydrogenase; Provisional 98.52
PRK08703239 short chain dehydrogenase; Provisional 98.52
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 98.52
PRK07035252 short chain dehydrogenase; Provisional 98.51
PLN02253280 xanthoxin dehydrogenase 98.51
KOG0725|consensus270 98.51
PRK10538248 malonic semialdehyde reductase; Provisional 98.51
PLN02653 340 GDP-mannose 4,6-dehydratase 98.51
PRK12938246 acetyacetyl-CoA reductase; Provisional 98.51
PRK08340259 glucose-1-dehydrogenase; Provisional 98.51
PRK08085254 gluconate 5-dehydrogenase; Provisional 98.5
PRK06123248 short chain dehydrogenase; Provisional 98.5
PRK06198260 short chain dehydrogenase; Provisional 98.48
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 98.48
PRK05599246 hypothetical protein; Provisional 98.47
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 98.47
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 98.47
PRK08267260 short chain dehydrogenase; Provisional 98.47
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.47
PRK12939250 short chain dehydrogenase; Provisional 98.47
PLN02583 297 cinnamoyl-CoA reductase 98.46
PRK08628258 short chain dehydrogenase; Provisional 98.46
PRK12742237 oxidoreductase; Provisional 98.45
PLN00015308 protochlorophyllide reductase 98.45
PRK06125259 short chain dehydrogenase; Provisional 98.45
PLN02572 442 UDP-sulfoquinovose synthase 98.43
PLN02896 353 cinnamyl-alcohol dehydrogenase 98.42
PRK08226263 short chain dehydrogenase; Provisional 98.42
PRK05866293 short chain dehydrogenase; Provisional 98.4
PRK06947248 glucose-1-dehydrogenase; Provisional 98.4
KOG1610|consensus322 98.4
PRK06181263 short chain dehydrogenase; Provisional 98.39
PLN02780320 ketoreductase/ oxidoreductase 98.39
PRK05884223 short chain dehydrogenase; Provisional 98.39
PLN00198 338 anthocyanidin reductase; Provisional 98.38
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 98.38
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 98.38
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 98.37
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.37
PRK05875276 short chain dehydrogenase; Provisional 98.36
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 98.36
PRK07041230 short chain dehydrogenase; Provisional 98.35
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 98.34
PRK06914280 short chain dehydrogenase; Provisional 98.34
COG0623 259 FabI Enoyl-[acyl-carrier-protein] 98.34
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 98.33
PLN02240 352 UDP-glucose 4-epimerase 98.33
PLN02214 342 cinnamoyl-CoA reductase 98.32
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 98.32
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.32
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 98.32
PRK06057255 short chain dehydrogenase; Provisional 98.31
KOG1201|consensus300 98.31
PRK06138252 short chain dehydrogenase; Provisional 98.3
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.3
PRK08324681 short chain dehydrogenase; Validated 98.3
PRK09072263 short chain dehydrogenase; Provisional 98.3
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.29
KOG1210|consensus331 98.28
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 98.28
PRK05854313 short chain dehydrogenase; Provisional 98.26
PRK08251248 short chain dehydrogenase; Provisional 98.26
PRK08213259 gluconate 5-dehydrogenase; Provisional 98.26
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.25
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 98.25
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 98.25
PRK07201657 short chain dehydrogenase; Provisional 98.25
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.25
PRK10675 338 UDP-galactose-4-epimerase; Provisional 98.24
PRK12827249 short chain dehydrogenase; Provisional 98.23
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 98.23
PRK07775274 short chain dehydrogenase; Provisional 98.23
PRK12828239 short chain dehydrogenase; Provisional 98.22
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.22
PRK07326237 short chain dehydrogenase; Provisional 98.22
PRK12829264 short chain dehydrogenase; Provisional 98.22
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 98.21
PRK09186256 flagellin modification protein A; Provisional 98.21
PRK09135249 pteridine reductase; Provisional 98.2
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 98.2
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 98.2
PRK07023243 short chain dehydrogenase; Provisional 98.2
PRK06101240 short chain dehydrogenase; Provisional 98.19
PLN02650 351 dihydroflavonol-4-reductase 98.19
PRK12367245 short chain dehydrogenase; Provisional 98.18
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.17
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 98.17
PRK07774250 short chain dehydrogenase; Provisional 98.17
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 98.13
PRK07060245 short chain dehydrogenase; Provisional 98.11
PRK06940275 short chain dehydrogenase; Provisional 98.1
KOG1200|consensus256 98.09
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.08
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 98.07
PRK09009235 C factor cell-cell signaling protein; Provisional 98.06
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.06
PRK07102243 short chain dehydrogenase; Provisional 98.03
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 98.03
PRK07577234 short chain dehydrogenase; Provisional 98.02
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 98.02
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 98.01
PRK06196315 oxidoreductase; Provisional 98.0
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 98.0
PRK07453322 protochlorophyllide oxidoreductase; Validated 97.99
KOG1204|consensus253 97.98
PRK07904253 short chain dehydrogenase; Provisional 97.98
PRK06924251 short chain dehydrogenase; Provisional 97.98
PRK08219227 short chain dehydrogenase; Provisional 97.97
KOG4169|consensus261 97.96
PRK06197306 short chain dehydrogenase; Provisional 97.93
PLN02695 370 GDP-D-mannose-3',5'-epimerase 97.92
PRK06953222 short chain dehydrogenase; Provisional 97.92
PRK08264238 short chain dehydrogenase; Validated 97.92
smart00822180 PKS_KR This enzymatic domain is part of bacterial 97.88
PRK08017256 oxidoreductase; Provisional 97.88
PRK09291257 short chain dehydrogenase; Provisional 97.87
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 97.76
PF01073 280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 97.76
KOG1611|consensus249 97.74
PRK07074257 short chain dehydrogenase; Provisional 97.73
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 97.7
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 97.69
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 97.67
PRK06720169 hypothetical protein; Provisional 97.62
PRK07424406 bifunctional sterol desaturase/short chain dehydro 97.62
PF01370 236 Epimerase: NAD dependent epimerase/dehydratase fam 97.59
KOG1199|consensus260 97.56
PLN02427 386 UDP-apiose/xylose synthase 97.54
CHL00194 317 ycf39 Ycf39; Provisional 97.53
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 97.53
KOG1209|consensus289 97.52
PRK07806248 short chain dehydrogenase; Provisional 97.5
PRK08177225 short chain dehydrogenase; Provisional 97.48
PRK05865 854 hypothetical protein; Provisional 97.47
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 97.47
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 97.43
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 97.42
TIGR01746 367 Thioester-redct thioester reductase domain. It has 97.39
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 97.38
PLN02260 668 probable rhamnose biosynthetic enzyme 97.37
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 97.32
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 97.32
PLN02686 367 cinnamoyl-CoA reductase 97.26
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 97.11
PLN02166 436 dTDP-glucose 4,6-dehydratase 96.95
PLN02206 442 UDP-glucuronate decarboxylase 96.92
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.88
KOG1014|consensus312 96.87
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 96.8
PLN02778 298 3,5-epimerase/4-reductase 96.73
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 96.72
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 96.68
PLN02260 668 probable rhamnose biosynthetic enzyme 96.67
KOG1502|consensus 327 96.65
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 96.51
PRK12320 699 hypothetical protein; Provisional 96.5
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 96.44
COG1091 281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 96.14
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 96.1
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 95.99
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 95.96
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 95.93
PRK06732229 phosphopantothenate--cysteine ligase; Validated 95.92
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 95.9
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 95.86
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 95.65
KOG0023|consensus360 95.62
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 95.44
KOG1208|consensus314 95.43
PTZ00325 321 malate dehydrogenase; Provisional 95.39
KOG1371|consensus 343 95.33
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 95.18
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 95.18
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 94.82
>KOG4022|consensus Back     alignment and domain information
Probab=100.00  E-value=3.4e-33  Score=236.36  Aligned_cols=137  Identities=54%  Similarity=0.919  Sum_probs=133.8

Q ss_pred             CCCeEEEeCCCCCCCCchhhHHHHHhhCCCEEEEeeCCCCCCCCCceEEccCCchHHhHHHHHHHHHHhhcCCcccEEEE
Q psy5125          88 PGGLVSLPGAKPALEGTPANVDVAMELLYNWVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVIC  167 (227)
Q Consensus        88 ~~g~vv~tGA~gaLg~~~~m~~y~~s~~G~~V~~iD~~~~~~a~~~i~~~~d~~~~~~~~~v~~~v~~~lg~~~lDalvn  167 (227)
                      ..|||+++|++|+||+  .++.+|++ ++|||.+||+.+||+++.+|++..+.+|.||++.+.+++.+.++++++|+|+|
T Consensus         2 sagrVivYGGkGALGS--acv~~Fka-nnywV~siDl~eNe~Ad~sI~V~~~~swtEQe~~v~~~vg~sL~gekvDav~C   78 (236)
T KOG4022|consen    2 SAGRVIVYGGKGALGS--ACVEFFKA-NNYWVLSIDLSENEQADSSILVDGNKSWTEQEQSVLEQVGSSLQGEKVDAVFC   78 (236)
T ss_pred             CCceEEEEcCcchHhH--HHHHHHHh-cCeEEEEEeecccccccceEEecCCcchhHHHHHHHHHHHHhhcccccceEEE
Confidence            4689999999999999  99999999 99999999999999999999998899999999999999999999999999999


Q ss_pred             ccCCCCCCCCCCcchHHHHHHHHHhhHHHHHHHHHHHhhcccCCceEEeccCccccCCCC
Q psy5125         168 VAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP  227 (227)
Q Consensus       168 vAGGfa~G~~~~~~~~~~~d~M~~~Nl~Ta~~aa~aA~p~L~~~G~IV~vGA~aAl~~tp  227 (227)
                      |||||++|++++++.+++.|.||+|++||+-+++++|..||++||++.++||++|+.|||
T Consensus        79 VAGGWAGGnAksKdl~KNaDLMwKQSvwtSaIsa~lAt~HLK~GGLL~LtGAkaAl~gTP  138 (236)
T KOG4022|consen   79 VAGGWAGGNAKSKDLVKNADLMWKQSVWTSAISAKLATTHLKPGGLLQLTGAKAALGGTP  138 (236)
T ss_pred             eeccccCCCcchhhhhhchhhHHHHHHHHHHHHHHHHHhccCCCceeeecccccccCCCC
Confidence            999999999999999999999999999999999999999999999999999999999998



>KOG4022|consensus Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query227
1ooe_A236 Structural Genomics Of Caenorhabditis Elegans : Dih 1e-24
1hdr_A244 The Crystallographic Structure Of A Human Dihydropt 2e-22
1dir_A241 Crystal Structure Of A Monoclinic Form Of Dihydropt 3e-22
3orf_A251 Crystal Structure Of Dihydropteridine Reductase Fro 6e-04
>pdb|1OOE|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Dihydropteridine Reductase Length = 236 Back     alignment and structure

Iteration: 1

Score = 109 bits (272), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 52/107 (48%), Positives = 71/107 (66%) Query: 121 SIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVXXXXXXXXXXXK 180 +IDL+ NDQAD+NI+V+ + W EQE ++L + + L G ++D V CV K Sbjct: 32 NIDLSANDQADSNILVDGNKNWTEQEQSILEQTASSLQGSQVDGVFCVAGGWAGGSASSK 91 Query: 181 DFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP 227 DFVK+AD+M +QSVWSS +AA +A HLKPGGL+ L GA A+ TP Sbjct: 92 DFVKNADLMIKQSVWSSAIAAKLATTHLKPGGLLQLTGAAAAMGPTP 138
>pdb|1HDR|A Chain A, The Crystallographic Structure Of A Human Dihydropteridine Reductase Nadh Binary Complex Expressed In Escherichia Coli By A Cdna Constructed From Its Rat Homologue Length = 244 Back     alignment and structure
>pdb|1DIR|A Chain A, Crystal Structure Of A Monoclinic Form Of Dihydropteridine Reductase From Rat Liver Length = 241 Back     alignment and structure
>pdb|3ORF|A Chain A, Crystal Structure Of Dihydropteridine Reductase From Dictyostelium Discoideum Length = 251 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query227
1ooe_A236 Dihydropteridine reductase; structural genomics, P 9e-19
1ooe_A236 Dihydropteridine reductase; structural genomics, P 2e-12
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 5e-17
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 1e-10
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 2e-14
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 3e-10
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
 Score = 80.8 bits (200), Expect = 9e-19
 Identities = 61/110 (55%), Positives = 83/110 (75%)

Query: 118 WVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNA 177
            V +IDL+ NDQAD+NI+V+ +  W EQE ++L +  + L G ++D V CVAGGWAGG+A
Sbjct: 29  TVLNIDLSANDQADSNILVDGNKNWTEQEQSILEQTASSLQGSQVDGVFCVAGGWAGGSA 88

Query: 178 AAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP 227
           ++KDFVK+AD+M +QSVWSS +AA +A  HLKPGGL+ L GA  A+  TP
Sbjct: 89  SSKDFVKNADLMIKQSVWSSAIAAKLATTHLKPGGLLQLTGAAAAMGPTP 138


>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query227
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 99.83
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 99.83
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 99.82
3ged_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.82
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 99.81
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.8
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.79
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.79
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.76
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.75
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.75
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.74
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.73
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.73
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 99.73
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.72
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 99.72
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.72
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.72
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 99.72
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.72
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.72
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.72
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.72
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 99.72
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.72
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.72
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 99.71
3imf_A 257 Short chain dehydrogenase; structural genomics, in 99.71
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.71
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 99.71
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.71
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.71
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 99.71
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.71
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.71
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 99.71
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.71
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 99.71
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 99.71
4dqx_A 277 Probable oxidoreductase protein; structural genomi 99.71
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.71
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 99.71
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.71
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.7
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.7
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 99.7
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.7
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.7
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 99.7
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.7
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 99.7
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.7
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.7
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.7
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.7
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.69
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.69
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.69
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 99.69
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.69
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.69
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.69
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.69
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.69
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.69
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.69
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 99.69
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.69
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 99.68
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 99.68
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.68
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.68
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.68
3rih_A 293 Short chain dehydrogenase or reductase; structural 99.68
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.68
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.68
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.68
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.68
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.68
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.67
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.67
1spx_A 278 Short-chain reductase family member (5L265); paral 99.67
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.67
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.67
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.67
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.67
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.67
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.67
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.67
4e4y_A 244 Short chain dehydrogenase family protein; structur 99.67
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.67
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 99.67
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.67
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.67
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 99.67
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.67
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.67
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 99.67
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.67
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 99.66
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.66
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.66
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.66
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.66
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 99.66
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.66
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 99.66
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.66
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 99.66
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.66
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 99.65
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.65
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 99.65
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.65
3cxt_A 291 Dehydrogenase with different specificities; rossma 99.65
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.65
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.65
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.65
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.64
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.64
1xkq_A 280 Short-chain reductase family member (5D234); parra 99.64
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.64
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.64
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.64
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.64
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.64
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.64
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.64
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.64
1xhl_A 297 Short-chain dehydrogenase/reductase family member 99.64
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 99.63
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.63
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.63
3asu_A 248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.63
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.63
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 99.63
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.63
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 99.63
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.63
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.63
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.63
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.63
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.63
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.63
2ekp_A 239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.63
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 99.62
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 99.62
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.62
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 99.62
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.62
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 99.62
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.61
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.61
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.61
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.6
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.6
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.6
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 99.6
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.6
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.6
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.6
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.59
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 99.59
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.59
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.59
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.59
1xq1_A 266 Putative tropinone reducatse; structural genomics, 99.59
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.59
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.59
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.59
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.58
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.58
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.58
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.58
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.58
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.58
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.58
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.58
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.58
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.57
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.57
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.57
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.57
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.57
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.57
1zmo_A 244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.57
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.57
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.56
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.56
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.56
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.55
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.55
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.54
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.54
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.54
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.54
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.53
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.53
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.53
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.52
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.51
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.5
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.49
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.49
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.47
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.47
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.47
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 99.43
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.43
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.42
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.39
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.38
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.38
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.37
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 99.36
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.31
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.3
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.28
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.26
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.23
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 99.21
3mje_A 496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.2
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.19
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.18
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.17
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.15
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.14
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.13
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.13
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.12
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.12
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.11
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.11
2fr1_A 486 Erythromycin synthase, eryai; short chain dehydrog 99.11
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.11
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.11
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 99.1
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.1
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.09
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.09
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.08
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.08
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.08
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.08
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.08
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.08
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.08
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.07
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.06
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.06
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.06
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.06
2z5l_A 511 Tylkr1, tylactone synthase starter module and modu 99.06
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.06
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.06
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.06
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.05
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.05
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.05
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.05
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.05
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.04
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.04
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.04
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.04
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.04
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.04
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.04
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.03
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.03
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.03
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.03
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.03
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.03
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.02
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.02
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.02
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.02
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.02
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.01
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.01
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.01
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.01
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.01
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.01
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.01
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.01
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.0
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.0
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.0
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.0
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.0
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.0
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.0
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.0
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.0
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.0
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.0
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.0
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.0
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.0
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 98.99
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 98.99
3tjr_A301 Short chain dehydrogenase; structural genomics, se 98.99
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 98.99
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 98.99
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 98.99
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 98.99
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 98.99
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 98.98
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 98.98
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 98.98
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 98.98
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 98.98
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 98.98
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 98.98
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.98
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 98.98
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 98.98
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 98.97
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 98.97
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 98.97
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 98.97
4e4y_A244 Short chain dehydrogenase family protein; structur 98.97
3rih_A293 Short chain dehydrogenase or reductase; structural 98.96
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 98.96
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 98.96
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 98.96
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 98.96
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 98.96
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 98.96
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 98.96
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 98.96
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 98.96
1nff_A260 Putative oxidoreductase RV2002; directed evolution 98.96
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 98.95
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 98.95
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 98.95
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 98.95
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 98.95
1spx_A278 Short-chain reductase family member (5L265); paral 98.95
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 98.94
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 98.94
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 98.94
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 98.93
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 98.93
1xhl_A297 Short-chain dehydrogenase/reductase family member 98.93
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 98.92
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 98.92
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 98.92
3cxt_A291 Dehydrogenase with different specificities; rossma 98.92
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 98.92
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 98.92
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 98.92
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 98.91
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 98.91
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 98.91
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 98.91
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 98.91
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 98.91
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 98.91
1xkq_A280 Short-chain reductase family member (5D234); parra 98.9
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 98.9
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 98.9
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 98.9
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 98.9
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 98.9
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 98.9
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 98.89
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 98.89
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 98.89
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 98.89
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 98.88
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 98.88
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 98.88
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 98.87
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 98.87
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 98.87
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 98.87
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 98.86
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 98.86
3qlj_A322 Short chain dehydrogenase; structural genomics, se 98.86
1xq6_A 253 Unknown protein; structural genomics, protein stru 98.86
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 98.86
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 98.86
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 98.86
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 98.85
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 98.85
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 98.85
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 98.85
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 98.85
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 98.84
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 98.84
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 98.84
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 98.84
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 98.84
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 98.84
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 98.83
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 98.82
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 98.82
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 98.81
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 98.8
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 98.8
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 98.8
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 98.79
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 98.79
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 98.79
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 98.78
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 98.78
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 98.78
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 98.78
1xq1_A266 Putative tropinone reducatse; structural genomics, 98.77
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 98.77
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 98.76
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 98.76
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 98.76
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 98.76
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 98.76
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 98.76
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 98.75
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 98.75
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 98.74
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 98.74
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 98.74
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 98.74
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 98.74
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 98.73
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 98.73
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 98.73
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 98.73
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 98.72
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 98.72
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 98.71
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 98.71
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 98.7
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 98.7
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 98.7
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 98.7
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 98.7
3r6d_A 221 NAD-dependent epimerase/dehydratase; structural ge 98.69
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 98.69
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 98.68
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 98.68
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 98.68
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 98.68
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 98.68
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 98.68
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 98.68
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 98.67
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 98.67
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 98.67
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 98.67
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 98.66
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 98.66
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 98.66
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 98.65
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 98.65
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 98.65
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 98.64
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 98.64
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 98.64
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 98.63
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 98.62
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 98.62
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 98.61
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 98.6
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 98.6
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 98.58
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 98.58
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 98.58
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 98.58
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 98.57
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 98.57
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 98.57
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 98.56
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 98.55
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 98.55
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 98.53
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 98.53
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 98.53
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 98.53
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 98.53
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 98.52
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 98.51
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 98.5
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 98.5
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 98.47
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 98.45
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 98.44
4f6c_A 427 AUSA reductase domain protein; thioester reductase 98.42
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 98.4
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 98.36
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 98.36
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 98.35
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 98.35
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 98.35
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 98.35
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 98.33
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 98.33
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
Probab=99.83  E-value=1.2e-20  Score=167.62  Aligned_cols=135  Identities=18%  Similarity=0.145  Sum_probs=119.1

Q ss_pred             cCCCeEEEeCCCCCCCCchhhHHHHHhhCCCEEEEeeCCCCCC-------CCCceEEccCCchHHhHHHHHHHHHHhhcC
Q psy5125          87 KPGGLVSLPGAKPALEGTPANVDVAMELLYNWVGSIDLNPNDQ-------ADANIIVNKDDAWLEQETTVLAELKTILAG  159 (227)
Q Consensus        87 ~~~g~vv~tGA~gaLg~~~~m~~y~~s~~G~~V~~iD~~~~~~-------a~~~i~~~~d~~~~~~~~~v~~~v~~~lg~  159 (227)
                      ++|+++++|||+..+|.  +++..|+. +|++|++.|+.++..       ....+.+..|.++.++.+++.+.+.+.+| 
T Consensus        27 L~gKvalVTGas~GIG~--aiA~~la~-~Ga~V~i~~r~~~~l~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~G-  102 (273)
T 4fgs_A           27 LNAKIAVITGATSGIGL--AAAKRFVA-EGARVFITGRRKDVLDAAIAEIGGGAVGIQADSANLAELDRLYEKVKAEAG-  102 (273)
T ss_dssp             TTTCEEEEESCSSHHHH--HHHHHHHH-TTCEEEEEESCHHHHHHHHHHHCTTCEEEECCTTCHHHHHHHHHHHHHHHS-
T ss_pred             hCCCEEEEeCcCCHHHH--HHHHHHHH-CCCEEEEEECCHHHHHHHHHHcCCCeEEEEecCCCHHHHHHHHHHHHHHcC-
Confidence            45889999999999999  99999999 999999999875421       12334455788889999999999999898 


Q ss_pred             CcccEEEEccCCCCCCCCCCcchHHHHHHHHHhhHHHHHHHHHHHhhcccCCceEEeccCccccCCCC
Q psy5125         160 DKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP  227 (227)
Q Consensus       160 ~~lDalvnvAGGfa~G~~~~~~~~~~~d~M~~~Nl~Ta~~aa~aA~p~L~~~G~IV~vGA~aAl~~tp  227 (227)
                       +||.|||+||....+++. +.+.++||+++++|+++.|+++|+++|+|+++|+|||+++.++..|.|
T Consensus       103 -~iDiLVNNAG~~~~~~~~-~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~G~IInisS~~~~~~~~  168 (273)
T 4fgs_A          103 -RIDVLFVNAGGGSMLPLG-EVTEEQYDDTFDRNVKGVLFTVQKALPLLARGSSVVLTGSTAGSTGTP  168 (273)
T ss_dssp             -CEEEEEECCCCCCCCCTT-SCCHHHHHHHHHHHTHHHHHHHHHHTTTEEEEEEEEEECCGGGGSCCT
T ss_pred             -CCCEEEECCCCCCCCChh-hccHHHHHHHHHHHhHHHHHHHHHHHHHHhhCCeEEEEeehhhccCCC
Confidence             899999999999988864 889999999999999999999999999999999999999999988765



>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query227
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.91
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.89
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.82
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.81
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.81
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.81
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.81
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 99.8
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.79
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.79
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 99.79
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.79
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.78
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.78
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.77
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.77
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.77
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 99.76
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.76
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.76
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.76
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 99.76
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.75
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.75
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.75
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 99.75
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.74
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.74
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.73
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.72
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.72
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.72
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.72
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.71
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.7
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.7
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.7
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.7
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.7
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 99.69
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 99.69
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.69
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.68
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.68
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.67
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.67
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.66
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.66
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.61
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.6
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.6
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.59
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.58
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.55
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.53
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.52
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.48
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.41
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.4
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.38
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.36
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.36
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.36
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.34
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.33
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.33
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.32
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.32
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.31
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.31
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.31
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.3
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.3
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.29
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.28
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.28
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.28
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.27
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.25
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.25
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.25
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.25
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.24
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.24
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.22
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.21
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.21
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.2
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.18
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.18
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.17
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.16
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.16
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.12
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.11
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.1
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.07
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.05
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.05
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.04
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.02
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.02
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.02
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.01
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.01
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.0
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 98.98
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 98.98
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 98.98
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 98.97
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 98.95
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 98.94
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 98.94
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 98.93
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 98.92
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 98.86
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 98.83
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 98.8
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 98.72
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 98.59
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 98.53
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 98.51
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.32
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 98.29
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 98.26
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 98.2
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.2
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 98.13
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 98.05
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 98.04
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 98.02
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.01
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.94
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 97.88
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 97.84
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 97.82
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 97.81
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 97.78
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 97.71
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 97.68
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 97.65
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 97.63
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.61
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 97.59
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.58
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 97.57
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 97.54
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 97.52
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 97.45
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 97.4
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 97.38
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 97.36
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 97.35
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 97.27
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 97.25
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 97.23
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 97.21
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 97.2
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 97.15
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 97.14
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 97.08
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.07
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.0
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 96.98
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 96.93
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.91
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 96.87
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 96.87
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 96.86
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.86
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 96.83
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.75
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 96.71
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 96.5
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.5
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 96.32
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.3
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 96.15
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.07
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.01
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 96.0
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.9
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 95.73
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.64
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 95.28
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.67
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 93.79
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 92.36
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 91.89
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 91.27
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 90.41
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 90.0
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 89.99
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 89.99
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 89.49
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 88.89
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 88.23
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 88.12
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 84.35
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 84.1
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 82.14
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 82.12
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 81.99
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 80.44
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Dihydropteridin reductase (pteridine reductase)
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.91  E-value=3.5e-24  Score=181.75  Aligned_cols=137  Identities=45%  Similarity=0.789  Sum_probs=125.3

Q ss_pred             CCCeEEEeCCCCCCCCchhhHHHHHhhCCCEEEEeeCCCCCCCCCceEEccCCchHHhHHHHHHHHHHhhcCCcccEEEE
Q psy5125          88 PGGLVSLPGAKPALEGTPANVDVAMELLYNWVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVIC  167 (227)
Q Consensus        88 ~~g~vv~tGA~gaLg~~~~m~~y~~s~~G~~V~~iD~~~~~~a~~~i~~~~d~~~~~~~~~v~~~v~~~lg~~~lDalvn  167 (227)
                      +|++|++|||++.+|.  +++..+++ +||+|+++|+.++++.+..+....+.++.++.+.+.+.+.+.++.+++|.|||
T Consensus         1 egK~vlITGas~GIG~--a~a~~l~~-~G~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iD~lIn   77 (236)
T d1dhra_           1 EARRVLVYGGRGALGS--RCVQAFRA-RNWWVASIDVVENEEASASVIVKMTDSFTEQADQVTAEVGKLLGDQKVDAILC   77 (236)
T ss_dssp             CCCEEEEETTTSHHHH--HHHHHHHT-TTCEEEEEESSCCTTSSEEEECCCCSCHHHHHHHHHHHHHHHHTTCCEEEEEE
T ss_pred             CCCEEEEECCCCHHHH--HHHHHHHH-CCCEEEEEeCCccccccccceeecccCcHHHHHHHHHHHHHHhCCCCceEEEE
Confidence            4789999999999999  99999999 99999999999888777766666677778888888888888888778999999


Q ss_pred             ccCCCCCCCCCCcchHHHHHHHHHhhHHHHHHHHHHHhhcccCCceEEeccCccccCCCC
Q psy5125         168 VAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP  227 (227)
Q Consensus       168 vAGGfa~G~~~~~~~~~~~d~M~~~Nl~Ta~~aa~aA~p~L~~~G~IV~vGA~aAl~~tp  227 (227)
                      +||+|.+++..++.+.++||++|+.|+++.++++|+++|+|+++|+|||+|+.++..|.|
T Consensus        78 nAG~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~m~~~G~Iv~isS~~~~~~~~  137 (236)
T d1dhra_          78 VAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTP  137 (236)
T ss_dssp             CCCCCCCBCTTCTTHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEECCGGGGSCCT
T ss_pred             CCcccccccchhcCCHHHHHHHHHHcchHHHHHHHHHHHhcccccceeEEccHHHcCCcc
Confidence            999999988888889999999999999999999999999999999999999999998865



>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure