Diaphorina citri psyllid: psy513

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
SKQTGSASGVDSTQQHSPSNCPLDKDQLGQHTWGFLHTVAAYYPDKPSSDQQKDMSTFFTLLSKFYPCEVCATDLAEQLKVRPPATSSQSSLSQWLCWLHNGVNEKLGKPLFDCTKVNERWRDGWSDGS
cccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccccccc
*************************DQLGQHTWGFLHTVAAYYPDKPSSDQQKDMSTFFTLLSKFYPCEVCATDLAEQLKV********SSLSQWLCWLHNGVNEKLGKPLFDCTKVNERWRDGWSD**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SKQTGSASGVDSTQQHSPSNCPLDKDQLGQHTWGFLHTVAAYYPDKPSSDQQKDMSTFFTLLSKFYPCEVCATDLAEQLKVRPPATSSQSSLSQWLCWLHNGVNEKLGKPLFDCTKVNERWRDGWSDGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
FAD-linked sulfhydryl oxidase ALR FAD-dependent sulfhydryl oxidase. Within the mitochondrial intermembrane space, participates in a chain of disulfide exchange reactions with MIA40, that generate disulfide bonds in a number of resident proteins with twin Cx3C and Cx9C motifs.confidentP56213
FAD-linked sulfhydryl oxidase ALR FAD-dependent sulfhydryl oxidase that catalyzes disulfide bond formation. Within the mitochondrial intermembrane space, participates in a chain of disulfide exchange reactions with MIA40, that generate disulfide bonds in a number of resident proteins with twin Cx3C and Cx9C motifs. May have a function in liver regeneration and spermatogenesis.confidentQ63042
FAD-linked sulfhydryl oxidase ALR Isoform 2: May act as an autocrine hepatotrophic growth factor promoting liver regeneration.confidentP55789

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016971 [MF]flavin-linked sulfhydryl oxidase activityprobableGO:0016972, GO:0003824, GO:0016670, GO:0003674, GO:0016667, GO:0016491
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0006879 [BP]cellular iron ion homeostasisprobableGO:0019725, GO:0006875, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0055072, GO:0044763, GO:0008150, GO:0030003, GO:0055065, GO:0055080, GO:0065007, GO:0055082, GO:0065008, GO:0044699
GO:0050660 [MF]flavin adenine dinucleotide bindingprobableGO:0043168, GO:0050662, GO:0097159, GO:0043167, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0000166, GO:1901363, GO:1901265
GO:0015035 [MF]protein disulfide oxidoreductase activityprobableGO:0003824, GO:0016491, GO:0003674, GO:0016667, GO:0015036

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.8.-.-Acting on a sulfur group of donors.probable
1.8.3.-With oxygen as acceptor.probable
1.8.3.2Thiol oxidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HJ3, chain A
Confidence level:very confident
Coverage over the Query: 22-122
View the alignment between query and template
View the model in PyMOL