Diaphorina citri psyllid: psy5160

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---

MSAYKSGLQSSEKFNLIQILKLNPKAPGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAESTVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKDKSNYEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDNPYKKHGNIPL

ccccccccEEcccccEEEEEEccccccccccccHHHHHHHHHHHcccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHcccccccccEEEEccccHHHHccHHHHHHHHHHcHHHccccHHHHHHHHccHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccccccccc

***YKSGLQSSEKFNLIQILKLNPKAPGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAESTVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKDKSNYEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDNPYKKHGNIPL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable propionyl-CoA carboxylase beta chain 5		confident	P53002
Propionyl-CoA carboxylase beta chain		confident	P53003
Propionyl-CoA carboxylase beta chain, mitochondrial		confident	Q2TBR0

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0015977 [BP]	carbon fixation	probable	GO:0071704, GO:0044710, GO:0008150, GO:0008152
GO:0004658 [MF]	propionyl-CoA carboxylase activity	probable	GO:0016874, GO:0003674, GO:0016885, GO:0016421, GO:0003824
GO:0003989 [MF]	acetyl-CoA carboxylase activity	probable	GO:0016874, GO:0003674, GO:0016885, GO:0016421, GO:0003824
GO:1901564 [BP]	organonitrogen compound metabolic process	probable	GO:0071704, GO:0006807, GO:0008150, GO:0008152
GO:0045335 [CC]	phagocytic vesicle	probable	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0006631 [BP]	fatty acid metabolic process	probable	GO:0044238, GO:0044710, GO:0006629, GO:0006082, GO:0009987, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0009317 [CC]	acetyl-CoA carboxylase complex	probable	GO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046395 [BP]	carboxylic acid catabolic process	probable	GO:0044712, GO:1901575, GO:0008152, GO:0006082, GO:0044237, GO:0016054, GO:0009987, GO:0044710, GO:0019752, GO:0044248, GO:0071704, GO:0008150, GO:0044281, GO:0044282, GO:0043436, GO:0009056
GO:0005618 [CC]	cell wall	probable	GO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1X0U, chain A
Confidence level:very confident
Coverage over the Query: 10-203
View the alignment between query and template
View the model in PyMOL