Psyllid ID: psy5160

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MSAYKSGLQSSEKFNLIQILKLNPKAPGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAESTVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKDKSNYEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDNPYKKHGNIPL
ccccccccEEcccccEEEEEEccccccccccccHHHHHHHHHHHcccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHcccccccccEEEEccccHHHHccHHHHHHHHHHcHHHccccHHHHHHHHccHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccccccccc
cccccEEEEEEccccEEEEEEccccEcHcEcHHHHHHHHHHHHHHHHccccEEEEEEEccEcccHHHHHccHHHHHHHHHHHHHHccccEEEEEEEEEEHHHHHccccHHHcccEEEEccccEEEcccHHHHHHHHcHHHHHHHHcHHHHHHHHccHHHHHHcccccEEccHHHHHHHHHHHHHHHHHccccccccccccccc
msayksglqsseKFNLIQIlklnpkapgcidinAAVKSARFIRfcdafnipivtfidvpgflpglaQEHLGIIRHGSKLLYAYAESTVPKITVITRKAYGGAYAVMSEKnlrsdvnyawptaEIAVMGSKGAVAILYRKekdksnyeveyndkfrspvaaakkgyiddiieprtTRMRIAQDLKFLLNkkqdnpykkhgnipl
msayksglqssEKFNLIQILKLNPKAPGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAESTVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEkdksnyeveyndkfrspvaaakkgyiddiieprtTRMRIAQDLKFllnkkqdnpykkhgnipl
MSAYKSGLQSSEKFNLIQILKLNPKAPGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAESTVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKDKSNYEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDNPYKKHGNIPL
*************FNLIQILKLNPKAPGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAESTVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKDKSNYEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLL****************
***YKSGLQSSEKFNLIQILKLNPKAPGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAESTVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKDKSNYEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDNPYKKHGNIPL
**********SEKFNLIQILKLNPKAPGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAESTVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKDKSNYEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDNPYKKHGNIPL
***YKSGLQSSEKFNLIQILKLNPKAPGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAESTVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKDKSNYEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDN**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAYKSGLQSSEKFNLIQILKLNPKAPGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAESTVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKDKSNYEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDNPYKKHGNIPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query203 2.2.26 [Sep-21-2011]
Q99MN9541 Propionyl-CoA carboxylase yes N/A 0.876 0.329 0.657 1e-68
P05166539 Propionyl-CoA carboxylase yes N/A 0.921 0.346 0.627 3e-68
P79384539 Propionyl-CoA carboxylase yes N/A 0.921 0.346 0.632 4e-68
P07633541 Propionyl-CoA carboxylase yes N/A 0.876 0.329 0.646 5e-68
Q2TBR0539 Propionyl-CoA carboxylase yes N/A 0.921 0.346 0.622 1e-67
P53003546 Propionyl-CoA carboxylase yes N/A 0.866 0.322 0.558 7e-58
P53002549 Probable propionyl-CoA ca yes N/A 0.866 0.320 0.585 6e-57
P96885548 Probable propionyl-CoA ca yes N/A 0.866 0.321 0.558 7e-56
P54541507 Putative propionyl-CoA ca yes N/A 0.921 0.368 0.545 2e-54
Q8GBW6611 Methylmalonyl-CoA carboxy N/A N/A 0.866 0.288 0.527 1e-53
>sp|Q99MN9|PCCB_MOUSE Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus GN=Pccb PE=1 SV=2 Back     alignment and function desciption
 Score =  259 bits (662), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 117/178 (65%), Positives = 146/178 (82%)

Query: 26  APGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAE 85
           A GC+DIN++VK ARF+RFCDAFNIP++TF+DVPGFLPG AQE+ GIIRHG+KLLYA+AE
Sbjct: 364 ASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAE 423

Query: 86  STVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKDKSN 145
           +TVPKITVITRKAYGGAY VMS K+L  D NYAWPTAEIAVMG+KGAV I+++  +D   
Sbjct: 424 ATVPKITVITRKAYGGAYDVMSSKHLLGDTNYAWPTAEIAVMGAKGAVEIIFKGHQDVEA 483

Query: 146 YEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDNPYKKHGNIPL 203
            + EY +KF +P  AA +G++DDII+P +TR RI  DL+ L +KK   P++KH NIPL
Sbjct: 484 AQAEYVEKFANPFPAAVRGFVDDIIQPSSTRARICCDLEVLASKKVHRPWRKHANIPL 541

Mus musculus (taxid: 10090)
EC: 6EC: .EC: 4EC: .EC: 1EC: .EC: 3
>sp|P05166|PCCB_HUMAN Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens GN=PCCB PE=1 SV=3 Back     alignment and function description
>sp|P79384|PCCB_PIG Propionyl-CoA carboxylase beta chain, mitochondrial OS=Sus scrofa GN=PCCB PE=2 SV=1 Back     alignment and function description
>sp|P07633|PCCB_RAT Propionyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus GN=Pccb PE=2 SV=1 Back     alignment and function description
>sp|Q2TBR0|PCCB_BOVIN Propionyl-CoA carboxylase beta chain, mitochondrial OS=Bos taurus GN=PCCB PE=2 SV=1 Back     alignment and function description
>sp|P53003|PCCB_SACEN Propionyl-CoA carboxylase beta chain OS=Saccharopolyspora erythraea (strain NRRL 23338) GN=pccB PE=3 SV=2 Back     alignment and function description
>sp|P53002|PCCB_MYCLE Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium leprae (strain TN) GN=accD5 PE=3 SV=1 Back     alignment and function description
>sp|P96885|PCC5_MYCTU Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium tuberculosis GN=accD5 PE=1 SV=1 Back     alignment and function description
>sp|P54541|PCCB_BACSU Putative propionyl-CoA carboxylase beta chain OS=Bacillus subtilis (strain 168) GN=yqjD PE=3 SV=2 Back     alignment and function description
>sp|Q8GBW6|12S_PROFR Methylmalonyl-CoA carboxyltransferase 12S subunit OS=Propionibacterium freudenreichii subsp. shermanii PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query203
391335540 531 PREDICTED: propionyl-CoA carboxylase bet 0.921 0.352 0.691 2e-73
198428113 536 PREDICTED: similar to propionyl Coenzyme 0.876 0.332 0.691 6e-73
91082493 537 PREDICTED: similar to LOC613054 protein 0.876 0.331 0.707 9e-73
321457584 538 hypothetical protein DAPPUDRAFT_301272 [ 0.921 0.347 0.691 1e-72
339246713 539 propionyl-CoA carboxylase, beta subunit 0.921 0.346 0.670 2e-72
348510789 560 PREDICTED: propionyl-CoA carboxylase bet 0.921 0.333 0.670 3e-72
156375249 547 predicted protein [Nematostella vectensi 0.881 0.327 0.692 5e-72
147904714 541 propionyl CoA carboxylase, beta polypept 0.921 0.345 0.664 2e-71
38511450 541 MGC68650 protein [Xenopus laevis] 0.921 0.345 0.664 3e-71
432936660 560 PREDICTED: propionyl-CoA carboxylase bet 0.921 0.333 0.659 4e-71
>gi|391335540|ref|XP_003742148.1| PREDICTED: propionyl-CoA carboxylase beta chain, mitochondrial [Metaseiulus occidentalis] Back     alignment and taxonomy information
 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 157/188 (83%), Gaps = 1/188 (0%)

Query: 17  IQILKLNPK-APGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRH 75
           + I+  NPK A GC+DIN++VK ARF+RFCDAFNIPIVT +DVPGFLPG +QE+ GIIRH
Sbjct: 344 VGIVGNNPKYAAGCLDINSSVKGARFVRFCDAFNIPIVTLVDVPGFLPGTSQEYNGIIRH 403

Query: 76  GSKLLYAYAESTVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAI 135
           G+KLLYAYAE+T PK+T+ITRKAYGGAY VMS K+LR DVNYAWPTAE+AVMG+KGAV+I
Sbjct: 404 GAKLLYAYAEATAPKVTIITRKAYGGAYDVMSSKHLRGDVNYAWPTAEVAVMGAKGAVSI 463

Query: 136 LYRKEKDKSNYEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDNPY 195
           LYR   + + YE EY DKF +P +AA +G++DDIIEP +TRMRI +DL  L +KK  NP 
Sbjct: 464 LYRGSDNVARYEQEYIDKFTNPFSAAVRGFVDDIIEPHSTRMRICRDLNMLRDKKLSNPP 523

Query: 196 KKHGNIPL 203
           KKHGNIPL
Sbjct: 524 KKHGNIPL 531

Source: Metaseiulus occidentalis

Species: Metaseiulus occidentalis

Genus: Metaseiulus

Family: Phytoseiidae

Order: Mesostigmata

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|198428113|ref|XP_002128673.1| PREDICTED: similar to propionyl Coenzyme A carboxylase, beta polypeptide [Ciona intestinalis] Back     alignment and taxonomy information
>gi|91082493|ref|XP_972751.1| PREDICTED: similar to LOC613054 protein [Tribolium castaneum] gi|270007138|gb|EFA03586.1| hypothetical protein TcasGA2_TC013669 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|321457584|gb|EFX68668.1| hypothetical protein DAPPUDRAFT_301272 [Daphnia pulex] Back     alignment and taxonomy information
>gi|339246713|ref|XP_003374990.1| propionyl-CoA carboxylase, beta subunit [Trichinella spiralis] gi|316971730|gb|EFV55471.1| propionyl-CoA carboxylase, beta subunit [Trichinella spiralis] Back     alignment and taxonomy information
>gi|348510789|ref|XP_003442927.1| PREDICTED: propionyl-CoA carboxylase beta chain, mitochondrial-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|156375249|ref|XP_001629994.1| predicted protein [Nematostella vectensis] gi|156217006|gb|EDO37931.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|147904714|ref|NP_001083656.1| propionyl CoA carboxylase, beta polypeptide [Xenopus laevis] gi|62740260|gb|AAH94074.1| MGC68650 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|38511450|gb|AAH61665.1| MGC68650 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|432936660|ref|XP_004082216.1| PREDICTED: propionyl-CoA carboxylase beta chain, mitochondrial-like [Oryzias latipes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query203
WB|WBGene00018701536 pccb-1 [Caenorhabditis elegans 0.921 0.348 0.645 6.7e-65
UNIPROTKB|E1BST9529 PCCB "Uncharacterized protein" 0.906 0.347 0.661 1.8e-64
UNIPROTKB|F1PTU4554 PCCB "Uncharacterized protein" 0.921 0.337 0.638 9.7e-64
DICTYBASE|DDB_G0276341553 pccB "propanoyl-CoA:carbon dio 0.886 0.325 0.679 1.6e-63
ZFIN|ZDB-GENE-040426-2467558 pccb "propionyl Coenzyme A car 0.876 0.318 0.670 4.2e-63
MGI|MGI:1914154541 Pccb "propionyl Coenzyme A car 0.876 0.329 0.657 2.3e-62
UNIPROTKB|P79384539 PCCB "Propionyl-CoA carboxylas 0.921 0.346 0.632 4.8e-62
UNIPROTKB|E7ETT1520 PCCB "Propionyl-CoA carboxylas 0.921 0.359 0.627 6.2e-62
UNIPROTKB|E7ETT4482 PCCB "Propionyl-CoA carboxylas 0.921 0.387 0.627 6.2e-62
UNIPROTKB|E7EUY3516 PCCB "Propionyl-CoA carboxylas 0.921 0.362 0.627 6.2e-62
WB|WBGene00018701 pccb-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 661 (237.7 bits), Expect = 6.7e-65, P = 6.7e-65
 Identities = 122/189 (64%), Positives = 156/189 (82%)

Query:    17 IQILKLNPK-APGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRH 75
             + I+  NPK A GC+DIN++VK ARF+RFCDAFNIPI+T +DVPGFLPG AQE+ GIIRH
Sbjct:   348 VGIVGNNPKFAAGCLDINSSVKGARFVRFCDAFNIPIITLVDVPGFLPGTAQEYGGIIRH 407

Query:    76 GSKLLYAYAESTVPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAI 135
             G+KLLYA+AE+TVPKIT+ITRKA+GGAY VMS K+LR D+NYAWPTAE+AVMG+KGAV+I
Sbjct:   408 GAKLLYAFAEATVPKITIITRKAFGGAYDVMSSKHLRGDINYAWPTAEVAVMGAKGAVSI 467

Query:   136 LYRKEKDKS-NYEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDNP 194
             L+R +K+ +  +E EY + F +P  AA +G++DDII P  TR ++ +DL  L +KK  NP
Sbjct:   468 LFRNDKEHAVQHEEEYTELFSNPFPAAVRGFVDDIIIPSETRKKVCEDLNMLESKKLKNP 527

Query:   195 YKKHGNIPL 203
             +KKHGNIPL
Sbjct:   528 WKKHGNIPL 536
GO:0016874 "ligase activity" evidence=IEA
UNIPROTKB|E1BST9 PCCB "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTU4 PCCB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0276341 pccB "propanoyl-CoA:carbon dioxide ligase beta subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2467 pccb "propionyl Coenzyme A carboxylase, beta polypeptide" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1914154 Pccb "propionyl Coenzyme A carboxylase, beta polypeptide" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P79384 PCCB "Propionyl-CoA carboxylase beta chain, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E7ETT1 PCCB "Propionyl-CoA carboxylase beta chain, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7ETT4 PCCB "Propionyl-CoA carboxylase beta chain, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EUY3 PCCB "Propionyl-CoA carboxylase beta chain, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P53002PCCB_MYCLE6, ., 4, ., 1, ., 30.58510.86690.3205yesN/A
P53003PCCB_SACEN6, ., 4, ., 1, ., 30.55850.86690.3223yesN/A
P05166PCCB_HUMAN6, ., 4, ., 1, ., 30.62760.92110.3469yesN/A
Q2TBR0PCCB_BOVIN6, ., 4, ., 1, ., 30.62230.92110.3469yesN/A
Q99MN9PCCB_MOUSE6, ., 4, ., 1, ., 30.65730.87680.3290yesN/A
P54541PCCB_BACSU6, ., 4, ., 1, ., 30.54590.92110.3688yesN/A
P79384PCCB_PIG6, ., 4, ., 1, ., 30.63290.92110.3469yesN/A
P07633PCCB_RAT6, ., 4, ., 1, ., 30.64600.87680.3290yesN/A
P96885PCC5_MYCTU6, ., 4, ., 1, ., 30.55850.86690.3211yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.4.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query203
COG4799526 COG4799, COG4799, Acetyl-CoA carboxylase, carboxyl 1e-84
TIGR01117512 TIGR01117, mmdA, methylmalonyl-CoA decarboxylase a 6e-84
pfam01039487 pfam01039, Carboxyl_trans, Carboxyl transferase do 1e-74
PLN02820569 PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxyla 2e-21
TIGR00513316 TIGR00513, accA, acetyl-CoA carboxylase, carboxyl 5e-09
COG0825317 COG0825, AccA, Acetyl-CoA carboxylase alpha subuni 3e-08
PRK05724319 PRK05724, PRK05724, acetyl-CoA carboxylase carboxy 1e-06
PLN03230431 PLN03230, PLN03230, acetyl-coenzyme A carboxylase 2e-05
CHL00198322 CHL00198, accA, acetyl-CoA carboxylase carboxyltra 5e-04
TIGR03134238 TIGR03134, malonate_gamma, malonate decarboxylase, 6e-04
PLN03229 762 PLN03229, PLN03229, acetyl-coenzyme A carboxylase 0.002
>gnl|CDD|227136 COG4799, COG4799, Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information 
 Score =  259 bits (664), Expect = 1e-84
 Identities = 109/189 (57%), Positives = 133/189 (70%), Gaps = 13/189 (6%)

Query: 28  GCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAEST 87
           G +DI++A K+ARFIR CDAFNIP+V  +D PGF+PG  QE+ GII+HG+KLLYA AE+T
Sbjct: 338 GVLDIDSADKAARFIRLCDAFNIPLVFLVDTPGFMPGTDQEYGGIIKHGAKLLYAVAEAT 397

Query: 88  VPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKDKSN-- 145
           VPKITVITRKAYGGAY VM  K L  D NYAWPTAEIAVMG +GAV+ILYRKE   +   
Sbjct: 398 VPKITVITRKAYGGAYYVMGGKALGPDFNYAWPTAEIAVMGPEGAVSILYRKELAAAERP 457

Query: 146 ----------YEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQ-DNP 194
                        EY ++F +P  AA++GYID +I+P  TR  + + L  L NK   + P
Sbjct: 458 EEREALLRKQLIAEYEEQFSNPYYAAERGYIDAVIDPADTRAVLGRALSALANKPVVETP 517

Query: 195 YKKHGNIPL 203
            KKHGNIPL
Sbjct: 518 LKKHGNIPL 526

Length = 526
>gnl|CDD|130187 TIGR01117, mmdA, methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>gnl|CDD|216259 pfam01039, Carboxyl_trans, Carboxyl transferase domain Back     alignment and domain information
>gnl|CDD|178415 PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>gnl|CDD|233004 TIGR00513, accA, acetyl-CoA carboxylase, carboxyl transferase, alpha subunit Back     alignment and domain information
>gnl|CDD|223895 COG0825, AccA, Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|235580 PRK05724, PRK05724, acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|178769 PLN03230, PLN03230, acetyl-coenzyme A carboxylase carboxyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|214393 CHL00198, accA, acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>gnl|CDD|234116 TIGR03134, malonate_gamma, malonate decarboxylase, gamma subunit Back     alignment and domain information
>gnl|CDD|178768 PLN03229, PLN03229, acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 203
COG4799526 Acetyl-CoA carboxylase, carboxyltransferase compon 100.0
TIGR01117512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 100.0
PF01039493 Carboxyl_trans: Carboxyl transferase domain; Inter 100.0
KOG0540|consensus536 100.0
PLN02820569 3-methylcrotonyl-CoA carboxylase, beta chain 100.0
PRK05724319 acetyl-CoA carboxylase carboxyltransferase subunit 100.0
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 100.0
TIGR00513316 accA acetyl-CoA carboxylase, carboxyl transferase, 100.0
TIGR03134238 malonate_gamma malonate decarboxylase, gamma subun 100.0
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase al 100.0
PLN03230431 acetyl-coenzyme A carboxylase carboxyl transferase 100.0
PRK05654292 acetyl-CoA carboxylase subunit beta; Validated 100.0
TIGR00515285 accD acetyl-CoA carboxylase, carboxyl transferase, 100.0
PLN03229 762 acetyl-coenzyme A carboxylase carboxyl transferase 100.0
CHL00174296 accD acetyl-CoA carboxylase beta subunit; Reviewed 99.95
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid m 99.95
PLN02820 569 3-methylcrotonyl-CoA carboxylase, beta chain 99.93
TIGR03133274 malonate_beta malonate decarboxylase, beta subunit 99.92
COG0777294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 99.92
TIGR01117 512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 99.91
PRK07189301 malonate decarboxylase subunit beta; Reviewed 99.91
COG4799 526 Acetyl-CoA carboxylase, carboxyltransferase compon 99.9
PF01039 493 Carboxyl_trans: Carboxyl transferase domain; Inter 99.9
PF06833234 MdcE: Malonate decarboxylase gamma subunit (MdcE); 99.85
KOG0540|consensus 536 99.61
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficienc 99.05
KOG0368|consensus2196 98.87
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 98.82
PRK05674265 gamma-carboxygeranoyl-CoA hydratase; Validated 98.81
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptid 98.78
PRK06144262 enoyl-CoA hydratase; Provisional 98.77
PRK06143256 enoyl-CoA hydratase; Provisional 98.77
TIGR02280256 PaaB1 phenylacetate degradation probable enoyl-CoA 98.76
PRK08150255 enoyl-CoA hydratase; Provisional 98.76
PRK09076258 enoyl-CoA hydratase; Provisional 98.75
PRK09245266 enoyl-CoA hydratase; Provisional 98.74
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 98.72
PRK06023251 enoyl-CoA hydratase; Provisional 98.71
PRK08138261 enoyl-CoA hydratase; Provisional 98.71
PRK06688259 enoyl-CoA hydratase; Provisional 98.7
PRK08139266 enoyl-CoA hydratase; Validated 98.7
PRK08140262 enoyl-CoA hydratase; Provisional 98.7
PRK06213229 enoyl-CoA hydratase; Provisional 98.69
PRK07659260 enoyl-CoA hydratase; Provisional 98.69
PF00378245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 98.68
PRK07511260 enoyl-CoA hydratase; Provisional 98.68
PRK06142272 enoyl-CoA hydratase; Provisional 98.68
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- 98.68
PRK05995262 enoyl-CoA hydratase; Provisional 98.67
PRK08272302 enoyl-CoA hydratase; Provisional 98.67
PRK09674255 enoyl-CoA hydratase-isomerase; Provisional 98.67
PRK06127269 enoyl-CoA hydratase; Provisional 98.67
PRK08258277 enoyl-CoA hydratase; Provisional 98.67
PRK07854243 enoyl-CoA hydratase; Provisional 98.66
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy 98.65
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb 98.65
PRK07112255 polyketide biosynthesis enoyl-CoA hydratase; Valid 98.65
PRK07327268 enoyl-CoA hydratase; Provisional 98.65
PRK05981266 enoyl-CoA hydratase; Provisional 98.64
TIGR01929259 menB naphthoate synthase (dihydroxynaphthoic acid 98.64
PRK09120275 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 98.64
PRK06495257 enoyl-CoA hydratase; Provisional 98.64
PRK05980260 enoyl-CoA hydratase; Provisional 98.62
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 98.62
PLN02664275 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA 98.6
PRK07110249 polyketide biosynthesis enoyl-CoA hydratase; Valid 98.6
PRK07468262 enoyl-CoA hydratase; Provisional 98.59
PRK07799263 enoyl-CoA hydratase; Provisional 98.58
PRK06190258 enoyl-CoA hydratase; Provisional 98.58
PRK07260255 enoyl-CoA hydratase; Provisional 98.58
cd07015172 Clp_protease_NfeD Nodulation formation efficiency 98.57
PRK03580261 carnitinyl-CoA dehydratase; Provisional 98.57
PRK08260296 enoyl-CoA hydratase; Provisional 98.57
PRK07396273 dihydroxynaphthoic acid synthetase; Validated 98.56
PRK06210272 enoyl-CoA hydratase; Provisional 98.55
PRK05862257 enoyl-CoA hydratase; Provisional 98.54
PLN02267239 enoyl-CoA hydratase/isomerase family protein 98.54
PRK06494259 enoyl-CoA hydratase; Provisional 98.52
PRK06563255 enoyl-CoA hydratase; Provisional 98.52
PRK07938249 enoyl-CoA hydratase; Provisional 98.52
PRK07658257 enoyl-CoA hydratase; Provisional 98.52
PRK08259254 enoyl-CoA hydratase; Provisional 98.51
PRK07657260 enoyl-CoA hydratase; Provisional 98.51
PRK05869222 enoyl-CoA hydratase; Validated 98.5
PRK08252254 enoyl-CoA hydratase; Provisional 98.5
PRK05864276 enoyl-CoA hydratase; Provisional 98.49
PRK08290288 enoyl-CoA hydratase; Provisional 98.47
PLN02600251 enoyl-CoA hydratase 98.45
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy 98.44
PRK05870249 enoyl-CoA hydratase; Provisional 98.44
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is 98.42
PLN02921327 naphthoate synthase 98.4
PLN03214278 probable enoyl-CoA hydratase/isomerase; Provisiona 98.4
PRK00277200 clpP ATP-dependent Clp protease proteolytic subuni 98.4
PRK07509262 enoyl-CoA hydratase; Provisional 98.39
PRK08321302 naphthoate synthase; Validated 98.38
PLN02888265 enoyl-CoA hydratase 98.37
PRK12553207 ATP-dependent Clp protease proteolytic subunit; Re 98.35
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi 98.28
TIGR00706207 SppA_dom signal peptide peptidase SppA, 36K type. 98.25
PRK08788287 enoyl-CoA hydratase; Validated 98.25
PRK07827260 enoyl-CoA hydratase; Provisional 98.25
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a se 98.25
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-de 98.22
PRK05617 342 3-hydroxyisobutyryl-CoA hydrolase; Provisional 98.21
PRK12478298 enoyl-CoA hydratase; Provisional 98.2
PRK14512197 ATP-dependent Clp protease proteolytic subunit; Pr 98.16
CHL00028200 clpP ATP-dependent Clp protease proteolytic subuni 98.16
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA 98.12
TIGR03222 546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 98.12
TIGR03200 360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy 98.08
PRK11730 715 fadB multifunctional fatty acid oxidation complex 98.06
PLN02874 379 3-hydroxyisobutyryl-CoA hydrolase-like protein 98.05
PRK14514221 ATP-dependent Clp protease proteolytic subunit; Pr 98.02
PRK06072248 enoyl-CoA hydratase; Provisional 98.02
cd07017171 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- 98.01
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 98.0
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Re 98.0
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA 98.0
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 97.97
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 97.97
PRK08184 550 benzoyl-CoA-dihydrodiol lyase; Provisional 97.96
TIGR00493191 clpP ATP-dependent Clp protease, proteolytic subun 97.95
TIGR00705584 SppA_67K signal peptide peptidase SppA, 67K type. 97.93
PLN02157 401 3-hydroxyisobutyryl-CoA hydrolase-like protein 97.91
PRK14513201 ATP-dependent Clp protease proteolytic subunit; Pr 97.9
PF00574182 CLP_protease: Clp protease; InterPro: IPR001907 In 97.88
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a 97.87
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 97.86
KOG0368|consensus 2196 97.85
PLN02851 407 3-hydroxyisobutyryl-CoA hydrolase-like protein 97.84
PLN02988 381 3-hydroxyisobutyryl-CoA hydrolase 97.79
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [ 97.75
PRK08184550 benzoyl-CoA-dihydrodiol lyase; Provisional 97.72
TIGR03222546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 97.66
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 97.6
KOG0840|consensus275 97.59
KOG1680|consensus290 97.53
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Po 97.39
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteas 97.39
PF01972285 SDH_sah: Serine dehydrogenase proteinase; InterPro 97.27
PRK11778330 putative inner membrane peptidase; Provisional 97.07
KOG0016|consensus266 96.97
PRK10949 618 protease 4; Provisional 96.79
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme me 96.58
PRK10949 618 protease 4; Provisional 93.06
KOG1679|consensus291 92.33
TIGR00705 584 SppA_67K signal peptide peptidase SppA, 67K type. 91.45
KOG1682|consensus287 88.56
PF01343154 Peptidase_S49: Peptidase family S49 peptidase clas 88.43
KOG1681|consensus292 88.4
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information 
Probab=100.00  E-value=5.8e-51  Score=370.19  Aligned_cols=194  Identities=57%  Similarity=0.935  Sum_probs=183.2

Q ss_pred             eeeCCeEEEEEEeCCC-CCcccCHHHHHHHHHHHHHHHhCCCcEEEEecCCCCCCcHHHHHhHHHHHHHHHHHHHHhCCC
Q psy5160          10 SSEKFNLIQILKLNPK-APGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAESTV   88 (203)
Q Consensus        10 ~~i~Gr~V~vva~d~~-~gG~~~~~~~~K~~r~i~~a~~~~lPlv~l~Dt~G~~~g~~~E~~g~~~~~a~~~~a~~~~~v   88 (203)
                      -.|+|+||||||||++ +||.|++++++|++|||++|+.++||||+|+|+|||++|..+|..|++++++++++++++++|
T Consensus       319 aRi~G~pVGiIANqp~~~~G~l~~~sa~KaArFI~~cd~~~iPlv~L~d~pGFm~G~~~E~~giik~Gakl~~A~aeatV  398 (526)
T COG4799         319 ARIDGRPVGIIANQPRHLGGVLDIDSADKAARFIRLCDAFNIPLVFLVDTPGFMPGTDQEYGGIIKHGAKLLYAVAEATV  398 (526)
T ss_pred             EEECCEEEEEEecCccccccccchHHHHHHHHHHHhhhccCCCeEEEeCCCCCCCChhHHhChHHHhhhHHHhhHhhccC
Confidence            3689999999999999 999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CEEEEEcCCCchhhhhhhhccCCCcceEEecCCCeeeeeCHHHHHHHHhcCchh------------hhhhHHHHhhhcCC
Q psy5160          89 PKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKD------------KSNYEVEYNDKFRS  156 (203)
Q Consensus        89 P~isvv~g~~~Gga~~~~~~~~~~~d~~~a~~~a~i~v~gp~~~~~i~~~~~~~------------~~e~~~~~~~~~~~  156 (203)
                      |+|+||+|++|||++++|+++.+.+||+||||+++++|||||+|++++|+.+++            .+++.++|.+.+.+
T Consensus       399 PkitvI~rkayGga~~~M~~~~~~~~~~~AwP~a~iaVMG~egAv~i~~~k~l~~~~~~~~~~~~~~~~~~~eY~~~~~~  478 (526)
T COG4799         399 PKITVITRKAYGGAYYVMGGKALGPDFNYAWPTAEIAVMGPEGAVSILYRKELAAAERPEEREALLRKQLIAEYEEQFSN  478 (526)
T ss_pred             CeEEEEecccccceeeeecCccCCCceeEecCcceeeecCHHHHHHHHHHHHhhcccCchhHHHHHHHHHHHHHHHhccc
Confidence            999999999999999999999999999999999999999999999999975533            13356778887789


Q ss_pred             HHHHHHcCCcceecCCcchHHHHHHHHHHhhcC-CCCCCCCCCCCCCC
Q psy5160         157 PVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNK-KQDNPYKKHGNIPL  203 (203)
Q Consensus       157 ~~~~~~~G~iD~Vi~p~~tR~~l~~~L~~l~~~-~~~~p~~~~~~~~~  203 (203)
                      |+.++++|+||+||+|.+||.+|.+.|+.+..+ ....|.|||+|+|+
T Consensus       479 p~~aa~r~~iD~vI~p~~tR~~L~~~l~~~~~k~~~~~~~kk~g~~~~  526 (526)
T COG4799         479 PYYAAERGYIDAVIDPADTRAVLGRALSALANKPVVETPLKKHGNIPL  526 (526)
T ss_pred             hHHHHHhCCCCcccCHHHHHHHHHHHHHHHhcCccccccccccCCCCC
Confidence            999999999999999999999999999999999 66788999999996

>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>KOG0540|consensus Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>TIGR03133 malonate_beta malonate decarboxylase, beta subunit Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>PRK07189 malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>PF06833 MdcE: Malonate decarboxylase gamma subunit (MdcE); InterPro: IPR009648 This family consists of several bacterial malonate decarboxylase gamma subunit proteins Back     alignment and domain information
>KOG0540|consensus Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>KOG0368|consensus Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07396 dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02267 enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02600 enoyl-CoA hydratase Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>PLN02921 naphthoate synthase Back     alignment and domain information
>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>PLN02888 enoyl-CoA hydratase Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>KOG0368|consensus Back     alignment and domain information
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PLN02988 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>KOG0840|consensus Back     alignment and domain information
>KOG1680|consensus Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily Back     alignment and domain information
>PRK11778 putative inner membrane peptidase; Provisional Back     alignment and domain information
>KOG0016|consensus Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>KOG1679|consensus Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>KOG1682|consensus Back     alignment and domain information
>PF01343 Peptidase_S49: Peptidase family S49 peptidase classification Back     alignment and domain information
>KOG1681|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query203
3n6r_B531 Crystal Structure Of The Holoenzyme Of Propionyl-co 3e-62
3ibb_A530 Propionyl-Coa Carboxylase Beta Subunit, D422a Lengt 2e-59
3iav_A530 Propionyl-Coa Carboxylase Beta Subunit, D422v Lengt 7e-59
3ib9_A530 Propionyl-Coa Carboxylase Beta Subunit, D422l Lengt 1e-58
1xnw_A530 Acyl-Coa Carboxylase Beta Subunit From S. Coelicolo 1e-58
1xnv_A530 Acyl-Coa Carboxylase Beta Subunit From S. Coelicolo 1e-58
3mfm_C530 Crystal Structures And Mutational Analyses Of Acyl- 1e-58
1x0u_A522 Crystal Structure Of The Carboxyl Transferase Subun 5e-57
2a7s_A548 Crystal Structure Of The Acyl-Coa Carboxylase, Accd 6e-57
1on3_A523 Transcarboxylase 12s Crystal Structure: Hexamer Ass 9e-57
2bzr_A548 Crystal Structure Of Accd5 (Rv3280), An Acyl-Coa Ca 4e-56
1vrg_A527 Crystal Structure Of Propionyl-coa Carboxylase, Bet 4e-54
3u9r_B555 Crystal Structure Of P. Aeruginosa 3-methylcrotonyl 2e-13
2f9y_A339 The Crystal Structure Of The Carboxyltransferase Su 2e-06
1pix_A587 Crystal Structure Of The Carboxyltransferase Subuni 2e-05
3gf3_A588 Glutaconyl-Coa Decarboxylase A Subunit From Clostri 9e-05
>pdb|3N6R|B Chain B, Crystal Structure Of The Holoenzyme Of Propionyl-coa Carboxylase (pcc) Length = 531 Back     alignment and structure 
Iteration: 1

 Score =  234 bits (597), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 102/180 (56%), Positives = 143/180 (79%), Gaps = 4/180 (2%)
Query: 28  GCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAEST 87
           GC+DI+++ K+ARF+RFCDAF IP++T IDVPGFLPG +QE+ G+I+HG+KLLYAY E+T
Sbjct: 352 GCLDIDSSRKAARFVRFCDAFEIPLLTLIDVPGFLPGTSQEYGGVIKHGAKLLYAYGEAT 411
Query: 88  VPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKE----KDK 143
           VP +TVITRKAYGGAY VMS K+LR+D NYAWPTAE+AVMG+KGA  I++R +    +  
Sbjct: 412 VPMVTVITRKAYGGAYVVMSSKHLRADFNYAWPTAEVAVMGAKGATEIIHRGDLGDPEKI 471
Query: 144 SNYEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDNPYKKHGNIPL 203
           + +  +Y ++F +P  A+++G++D++I+PR+TR R+A+    L NK    P+KKH NIPL
Sbjct: 472 AQHTADYEERFANPFVASERGFVDEVIQPRSTRKRVARAFASLRNKSVQMPWKKHDNIPL 531
>pdb|3IBB|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422a Length = 530 Back     alignment and structure
>pdb|3IAV|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422v Length = 530 Back     alignment and structure
>pdb|3IB9|A Chain A, Propionyl-Coa Carboxylase Beta Subunit, D422l Length = 530 Back     alignment and structure
>pdb|1XNW|A Chain A, Acyl-Coa Carboxylase Beta Subunit From S. Coelicolor (Pccb), Apo Form #2, Mutant D422i Length = 530 Back     alignment and structure
>pdb|1XNV|A Chain A, Acyl-Coa Carboxylase Beta Subunit From S. Coelicolor (Pccb), Apo Form #1 Length = 530 Back     alignment and structure
>pdb|3MFM|C Chain C, Crystal Structures And Mutational Analyses Of Acyl-Coa Carboxylase Subunit Of Streptomyces Coelicolor Length = 530 Back     alignment and structure
>pdb|1X0U|A Chain A, Crystal Structure Of The Carboxyl Transferase Subunit Of Putative Pcc Of Sulfolobus Tokodaii Length = 522 Back     alignment and structure
>pdb|2A7S|A Chain A, Crystal Structure Of The Acyl-Coa Carboxylase, Accd5, From Mycobacterium Tuberculosis Length = 548 Back     alignment and structure
>pdb|1ON3|A Chain A, Transcarboxylase 12s Crystal Structure: Hexamer Assembly And Substrate Binding To A Multienzyme Core (With Methylmalonyl-Coenzyme A And Methylmalonic Acid Bound) Length = 523 Back     alignment and structure
>pdb|2BZR|A Chain A, Crystal Structure Of Accd5 (Rv3280), An Acyl-Coa Carboxylase Beta-Subunit From Mycobacterium Tuberculosis Length = 548 Back     alignment and structure
>pdb|1VRG|A Chain A, Crystal Structure Of Propionyl-coa Carboxylase, Beta Subunit (tm0716) From Thermotoga Maritima At 2.30 A Resolution Length = 527 Back     alignment and structure
>pdb|3U9R|B Chain B, Crystal Structure Of P. Aeruginosa 3-methylcrotonyl-coa Carboxylase (mcc), Beta Subunit Length = 555 Back     alignment and structure
>pdb|2F9Y|A Chain A, The Crystal Structure Of The Carboxyltransferase Subunit Of Acc From Escherichia Coli Length = 339 Back     alignment and structure
>pdb|1PIX|A Chain A, Crystal Structure Of The Carboxyltransferase Subunit Of The Bacterial Ion Pump Glutaconyl-Coenzyme A Decarboxylase Length = 587 Back     alignment and structure
>pdb|3GF3|A Chain A, Glutaconyl-Coa Decarboxylase A Subunit From Clostridium Symbiosum Co-Crystallized With Glutaconyl-Coa Length = 588 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query203
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein c 1e-117
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid 1e-115
3iav_A530 Propionyl-COA carboxylase complex B subunit; accas 1e-115
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; 1e-115
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, s 1e-114
1x0u_A522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 1e-114
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION 2e-79
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 7e-78
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 3e-74
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 3e-63
3u9r_B555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 2e-50
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase 2e-07
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha; 2e-07
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Length = 531 Back     alignment and structure
 Score =  343 bits (881), Expect = e-117
 Identities = 102/180 (56%), Positives = 143/180 (79%), Gaps = 4/180 (2%)

Query: 28  GCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAEST 87
           GC+DI+++ K+ARF+RFCDAF IP++T IDVPGFLPG +QE+ G+I+HG+KLLYAY E+T
Sbjct: 352 GCLDIDSSRKAARFVRFCDAFEIPLLTLIDVPGFLPGTSQEYGGVIKHGAKLLYAYGEAT 411

Query: 88  VPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKE----KDK 143
           VP +TVITRKAYGGAY VMS K+LR+D NYAWPTAE+AVMG+KGA  I++R +    +  
Sbjct: 412 VPMVTVITRKAYGGAYVVMSSKHLRADFNYAWPTAEVAVMGAKGATEIIHRGDLGDPEKI 471

Query: 144 SNYEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDNPYKKHGNIPL 203
           + +  +Y ++F +P  A+++G++D++I+PR+TR R+A+    L NK    P+KKH NIPL
Sbjct: 472 AQHTADYEERFANPFVASERGFVDEVIQPRSTRKRVARAFASLRNKSVQMPWKKHDNIPL 531
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Length = 548 Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Length = 530 Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Length = 523 Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Length = 527 Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Length = 522 Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Length = 588 Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Length = 793 Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Length = 587 Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Length = 758 Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Length = 555 Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Length = 327 Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Length = 339 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query203
3iav_A530 Propionyl-COA carboxylase complex B subunit; accas 100.0
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein c 100.0
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid 100.0
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; 100.0
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, s 100.0
1x0u_A522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 100.0
3u9r_B555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 100.0
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION 100.0
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 100.0
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 100.0
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase 100.0
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase 100.0
3k8x_A758 Acetyl-COA carboxylase; transferase, carboxyltrans 100.0
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha; 100.0
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferas 99.96
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid 99.94
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, s 99.94
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; 99.94
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accas 99.94
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 99.93
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein c 99.93
3u9r_B 555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 99.92
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 99.92
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION 99.91
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 99.87
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 99.87
3viv_A230 441AA long hypothetical NFED protein; protein-pept 98.93
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 98.87
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 98.84
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 98.81
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 98.79
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 98.78
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 98.75
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 98.75
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 98.74
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 98.73
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 98.71
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 98.71
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 98.69
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 98.69
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 98.68
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 98.68
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 98.67
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 98.67
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 98.66
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 98.66
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 98.66
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 98.64
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 98.64
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 98.64
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 98.63
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 98.62
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 98.62
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 98.61
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 98.61
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 98.61
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 98.61
4fzw_A258 2,3-dehydroadipyl-COA hydratase; structural genomi 98.6
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 98.6
4fzw_C274 1,2-epoxyphenylacetyl-COA isomerase; structural ge 98.59
3lke_A263 Enoyl-COA hydratase; nysgrc, target 112 structural 98.59
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 98.58
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 98.57
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 98.56
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 98.55
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 98.54
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 98.54
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 98.53
2f6i_A215 ATP-dependent CLP protease, putative; structural g 98.53
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 98.53
3t3w_A279 Enoyl-COA hydratase; ssgcid, structural genomics, 98.53
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 98.52
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 98.51
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 98.48
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 98.48
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 98.47
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 98.46
3hrx_A254 Probable enoyl-COA hydratase; the spiral fold, the 98.45
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 98.41
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 98.41
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 98.41
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 98.39
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 98.38
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 98.38
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 98.37
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 98.37
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 98.36
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 98.34
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 98.34
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 98.33
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 98.33
4hdt_A 353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 98.32
3rst_A240 Signal peptide peptidase SPPA; alpha/beta protein 98.32
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 98.3
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 98.27
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 98.26
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 98.25
3ju1_A 407 Enoyl-COA hydratase/isomerase family protein; alph 98.23
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 98.22
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 98.22
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 98.21
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 98.2
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 98.18
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, 98.18
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 98.14
4gm2_A205 ATP-dependent CLP protease proteolytic subunit; st 98.13
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 98.12
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 98.11
3bpt_A 363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 98.08
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 98.03
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 98.02
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 97.89
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 97.67
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 97.62
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, 97.45
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
Probab=100.00  E-value=1.9e-50  Score=370.64  Aligned_cols=194  Identities=54%  Similarity=0.921  Sum_probs=184.3

Q ss_pred             eeeCCeEEEEEEeCCC-CCcccCHHHHHHHHHHHHHHHhCCCcEEEEecCCCCCCcHHHHHhHHHHHHHHHHHHHHhCCC
Q psy5160          10 SSEKFNLIQILKLNPK-APGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAESTV   88 (203)
Q Consensus        10 ~~i~Gr~V~vva~d~~-~gG~~~~~~~~K~~r~i~~a~~~~lPlv~l~Dt~G~~~g~~~E~~g~~~~~a~~~~a~~~~~v   88 (203)
                      -.++|+||+|||||++ ++|++++++++|++||+++|+++++|||+|+|||||++|.++|+.|++++++++++++++++|
T Consensus       327 arl~G~~Vgvian~~~~~~G~l~~~~a~Kaarfi~~c~~~~iPlv~lvDtpGf~~G~~~E~~gi~~~~Ak~l~a~a~a~v  406 (530)
T 3iav_A          327 GRVEGRPVGIVANQPMQFAGCLDITASEKAARFVRTCDAFNVPVLTFVDVPGFLPGVDQEHDGIIRRGAKLIFAYAEATV  406 (530)
T ss_dssp             EEETTEEEEEEEECTTSGGGCBCHHHHHHHHHHHHHHHHTTCCEEEEEEECCBCCCHHHHHTTHHHHHHHHHHHHHHCCS
T ss_pred             EEECCEEEEEEEecCcccCCCCCHHHHHHHHHHHHHHHhcCCCEEEEeeCCCCCccHHHHHhhHHHHHHHHHHHHHhCCC
Confidence            3689999999999999 999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CEEEEEcCCCchhhhhhhhccCCCcceEEecCCCeeeeeCHHHHHHHHhcCchh---------hhhhHHHHhhhcCCHHH
Q psy5160          89 PKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKD---------KSNYEVEYNDKFRSPVA  159 (203)
Q Consensus        89 P~isvv~g~~~Gga~~~~~~~~~~~d~~~a~~~a~i~v~gp~~~~~i~~~~~~~---------~~e~~~~~~~~~~~~~~  159 (203)
                      |+|+||+|++|||++++|+++.+.+|++||||+++++|||||++++|+|+++++         .+++.++|.++..+|++
T Consensus       407 P~itvI~g~~~GGa~~am~~~~~~~d~~~awp~a~~~Vm~~egaa~il~r~~~~~~~~d~~~~~~~~~~~y~~~~~~p~~  486 (530)
T 3iav_A          407 PLITVITRKAFGGAYVVMGSKHLGADLNLAWPTAQIAVMGAQGAVNILHRRTIADAGDDAEATRARLIQEYEDALLNPYT  486 (530)
T ss_dssp             CEEEEEEEEEEHHHHHHTTCGGGTCSEEEECTTCEEESSCHHHHHHHHTSTTTSTTCTTCHHHHHHHHHHHHHHHSSSHH
T ss_pred             CEEEEEeCCcchHHHHHhcCCCCCCCEEEEcCCceEecCCHHHHHHHHhhhhhhhcccCHHHHHHHHHHHHHHhcCCHHH
Confidence            999999999999999999999999999999999999999999999999987642         23455778777789999


Q ss_pred             HHHcCCcceecCCcchHHHHHHHHHHhhcCCCCCCCCCCCCCCC
Q psy5160         160 AAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDNPYKKHGNIPL  203 (203)
Q Consensus       160 ~~~~G~iD~Vi~p~~tR~~l~~~L~~l~~~~~~~p~~~~~~~~~  203 (203)
                      ++++|+||+||+|.|||++|+++|+.+.+++...|+|||||+|+
T Consensus       487 aa~~~~vD~VIdP~~TR~~l~~~l~~~~~k~~~~~~kkhg~~p~  530 (530)
T 3iav_A          487 AAERGYVDAVIMPSDTRRHIVRGLRQLRTKRESLPPKKHGNIPL  530 (530)
T ss_dssp             HHHTTSSSEECCGGGHHHHHHHHHHHHTTCCCCCCCCSCCCCCC
T ss_pred             HHhcCCCCcccCHHHHHHHHHHHHHHHhcCCccCCCCCCCCCCC
Confidence            99999999999999999999999999999999999999999996
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Back     alignment and structure
>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Back     alignment and structure
>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Back     alignment and structure
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Back     alignment and structure
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
>3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Back     alignment and structure
>4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 203
d2a7sa2271 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase com 3e-55
d1vrga2264 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase com 2e-54
d1xnya2263 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase com 1e-53
d1on3a2264 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltra 1e-52
d1pixa3299 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase 6e-38
d1uyra2404 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxyla 2e-37
d2f9ya1316 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase c 2e-24
d2f9yb1263 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase 5e-13
d1pixa2287 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A 2e-10
d1vrga1251 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase compl 1e-04
>d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 271 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Biotin dependent carboxylase carboxyltransferase domain
domain: Propionyl-CoA carboxylase complex B subunit, PccB
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score =  174 bits (442), Expect = 3e-55
 Identities = 104/188 (55%), Positives = 129/188 (68%), Gaps = 12/188 (6%)

Query: 28  GCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAEST 87
           GC+DINA+ K+ARF+R CD FNIPIV  +DVPGFLPG  QE+ GIIR G+KLLYAY E+T
Sbjct: 84  GCLDINASEKAARFVRTCDCFNIPIVMLVDVPGFLPGTDQEYNGIIRRGAKLLYAYGEAT 143

Query: 88  VPKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKDKS--- 144
           VPKITVITRKAYGGAY VM  K++  DVN AWPTA+IAVMG+ GAV  +YR++  ++   
Sbjct: 144 VPKITVITRKAYGGAYCVMGSKDMGCDVNLAWPTAQIAVMGASGAVGFVYRQQLAEAAAN 203

Query: 145 ---------NYEVEYNDKFRSPVAAAKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDNPY 195
                      + EY D   +P  AA++GY+D +I P  TR  I   L+ L  K    P 
Sbjct: 204 GEDIDKLRLRLQQEYEDTLVNPYVAAERGYVDAVIPPSHTRGYIGTALRLLERKIAQLPP 263

Query: 196 KKHGNIPL 203
           KKHGN+PL
Sbjct: 264 KKHGNVPL 271
>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Length = 264 Back     information, alignment and structure
>d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Length = 263 Back     information, alignment and structure
>d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Length = 264 Back     information, alignment and structure
>d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Length = 299 Back     information, alignment and structure
>d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 404 Back     information, alignment and structure
>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} Length = 316 Back     information, alignment and structure
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Length = 263 Back     information, alignment and structure
>d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Length = 287 Back     information, alignment and structure
>d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query203
d1on3a2264 Methylmalonyl-CoA carboxyltransferase (transcarbox 100.0
d1vrga2264 Propionyl-CoA carboxylase complex B subunit, PccB 100.0
d1xnya2263 Propionyl-CoA carboxylase complex B subunit, PccB 100.0
d2a7sa2271 Propionyl-CoA carboxylase complex B subunit, PccB 100.0
d1pixa3299 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 100.0
d2f9ya1316 Acetyl-coenzyme A carboxylase carboxyl transferase 100.0
d1uyra2404 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 100.0
d2f9yb1263 Acetyl-coenzyme A carboxylase carboxyl transferase 99.96
d1xnya1258 Propionyl-CoA carboxylase complex B subunit, PccB 99.95
d1pixa2287 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 99.95
d2a7sa1258 Propionyl-CoA carboxylase complex B subunit, PccB 99.94
d1on3a1253 Methylmalonyl-CoA carboxyltransferase (transcarbox 99.94
d1vrga1251 Propionyl-CoA carboxylase complex B subunit, PccB 99.94
d1uyra1333 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 99.88
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 98.77
d2f6qa1245 Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( 98.76
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 98.76
d1sg4a1249 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.75
d2a7ka1230 Carbapenem biosynthes protein CarB {Pectobacterium 98.67
d1ef8a_261 Methylmalonyl CoA decarboxylase {Escherichia coli 98.63
d1nzya_269 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., 98.53
d1wz8a1263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 98.53
d1szoa_249 6-oxo camphor hydrolase {Rhodococcus erythropolis 98.5
d1wdka4310 Fatty oxidation complex alpha subunit, N-terminal 98.49
d1hzda_266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 98.38
d1pjha_266 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.38
d1dcia_275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.34
d1mj3a_260 Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve 98.26
d1q52a_297 Naphthoate synthase MenB {Mycobacterium tuberculos 98.18
d2cbya1179 Clp protease, ClpP subunit {Mycobacterium tubercul 97.96
d1yg6a1183 Clp protease, ClpP subunit {Escherichia coli [TaxI 97.93
d1y7oa1192 Clp protease, ClpP subunit {Streptococcus pneumoni 97.92
d1tg6a1193 Clp protease, ClpP subunit {Human (Homo sapiens), 97.67
d2f6ia1190 Clp protease, ClpP subunit {Plasmodium falciparum 97.64
>d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Biotin dependent carboxylase carboxyltransferase domain
domain: Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S)
species: Propionibacterium freudenreichii [TaxId: 1744]

Probab=100.00  E-value=3e-54  Score=364.59  Aligned_cols=194  Identities=51%  Similarity=0.928  Sum_probs=181.8

Q ss_pred             eeeCCeEEEEEEeCCC-CCcccCHHHHHHHHHHHHHHHhCCCcEEEEecCCCCCCcHHHHHhHHHHHHHHHHHHHHhCCC
Q psy5160          10 SSEKFNLIQILKLNPK-APGCIDINAAVKSARFIRFCDAFNIPIVTFIDVPGFLPGLAQEHLGIIRHGSKLLYAYAESTV   88 (203)
Q Consensus        10 ~~i~Gr~V~vva~d~~-~gG~~~~~~~~K~~r~i~~a~~~~lPlv~l~Dt~G~~~g~~~E~~g~~~~~a~~~~a~~~~~v   88 (203)
                      -.++|+||||||||+. ++|++++++++|++||+++|++++||||+|+|||||++|.++|+.|+++++++++.++++++|
T Consensus        62 ari~G~~vgvian~~~~~~G~~~~~~a~Kaarfi~lc~~~~iPlv~l~D~pGf~~G~~~E~~g~i~~ga~~~~a~a~~~v  141 (264)
T d1on3a2          62 ARVNGRSVGIVANQPSVMSGCLDINASDKAAEFVNFCDSFNIPLVQLVDVPGFLPGVQQEYGGIIRHGAKMLYAYSEATV  141 (264)
T ss_dssp             EEETTEEEEEEEECTTSGGGCBCHHHHHHHHHHHHHHHHTTCCEEEEEEECCBCCCHHHHHTTHHHHHHHHHHHHHHCCS
T ss_pred             EEEecceEEEEeccchhcccccChHHHHHHHHHHHHHHhcCCceEEEeccccccccHHHHHHHHHHHHHHHHHHHHcCCC
Confidence            4689999999999999 999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CEEEEEcCCCchhhhhhhhccCCCcceEEecCCCeeeeeCHHHHHHHHhcCchh--------hhhhHHHHhhhcCCHHHH
Q psy5160          89 PKITVITRKAYGGAYAVMSEKNLRSDVNYAWPTAEIAVMGSKGAVAILYRKEKD--------KSNYEVEYNDKFRSPVAA  160 (203)
Q Consensus        89 P~isvv~g~~~Gga~~~~~~~~~~~d~~~a~~~a~i~v~gp~~~~~i~~~~~~~--------~~e~~~~~~~~~~~~~~~  160 (203)
                      |+|+||+|++||+++++|+++++.+||++|||++++++||||+++.++|+.+++        ..+..++|.+..++|+++
T Consensus       142 P~itvi~rkayG~g~~am~g~~~~~d~~~aWP~A~~~vMg~Egaa~v~~~~el~a~~~~~~~~~~~~~e~~~~~~~p~~a  221 (264)
T d1on3a2         142 PKITVVLRKAYGGSYLAMCNRDLGADAVYAWPSAEIAVMGAEGAANVIFRKEIKAADDPDAMRAEKIEEYQNAFNTPYVA  221 (264)
T ss_dssp             CEEEEEEEEEEHHHHHTTTCGGGTCSEEEECTTCEEESSCHHHHHHHHTHHHHHHSSCHHHHHHHHHHHHHHHHSSHHHH
T ss_pred             CEEEEEeccccCccccccccccCChhheeeHHhhHhhhccHHHHHHHHHhhhhhhhhhhhhhhHHHHHHHHHHhcCHHHH
Confidence            999999999999999999999999999999999999999999999999986543        122344565666899999


Q ss_pred             HHcCCcceecCCcchHHHHHHHHHHhhcCCCCCCCCCCCCCCC
Q psy5160         161 AKKGYIDDIIEPRTTRMRIAQDLKFLLNKKQDNPYKKHGNIPL  203 (203)
Q Consensus       161 ~~~G~iD~Vi~p~~tR~~l~~~L~~l~~~~~~~p~~~~~~~~~  203 (203)
                      +++|+||+||||+|||++|.++|+.+.+++...|+|||||+|-
T Consensus       222 A~~g~iD~VIdP~eTR~~L~~aLe~~~~k~~~~p~kkhGn~P~  264 (264)
T d1on3a2         222 AARGQVDDVIDPADTRRKIASALEMYATKRQTRPAKKHGNFPC  264 (264)
T ss_dssp             HHTTSSSEECCGGGHHHHHHHHHHHGGGCCCCCCCCSCCCCCC
T ss_pred             HHcCCCCeeECHHHHHHHHHHHHHHHhcCCCCCCCCCCCCCCC
Confidence            9999999999999999999999999999999999999999993
>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d2a7sa1 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure