Diaphorina citri psyllid: psy5166


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70------
MYLFSDEVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYEVNHEPELVIH
cEEEcccEEEEEccccccHHHHHHHHHHHHccccccEEEEEEEcccccccccccHHHHHHHHHHHHccccccEEEc
*YLFSDEVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYEVNH**ELVIH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLFSDEVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYEVNHEPELVIH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein kinase C iota type Calcium- and diacylglycerol-independent serine/ threonine-protein kinase that plays a general protective role against apoptotic stimuli, is involved in NF-kappa-B activation, cell survival, differentiation and polarity, and contributes to the regulation of microtubule dynamics in the early secretory pathway. Is necessary for BCR-ABL oncogene-mediated resistance to apoptotic drug in leukemia cells, protecting leukemia cells against drug-induced apoptosis. In cultured neurons, prevents amyloid beta protein-induced apoptosis by interrupting cell death process at a very early step. In glioblastoma cells, may function downstream of phosphatidylinositol 3-kinase (PI(3)K) and PDPK1 in the promotion of cell survival by phosphorylating and inhibiting the pro-apoptotic factor BAD. Can form a protein complex in non-small cell lung cancer (NSCLC) cells with PARD6A and ECT2 and regulate ECT2 oncogenic activity by phosphorylation, which in turn promotes transformed growth and invasion. In response to nerve growth factor (NGF), acts downstream of SRC to phosphorylate and activate IRAK1, allowing the subsequent activation of NF-kappa-B and neuronal cell survival. Functions in the organization of the apical domain in epithelial cells by phosphorylating EZR. This step is crucial for activation and normal distribution of EZR at the early stages of intestinal epithelial cell differentiation. Forms a protein complex with LLGL1 and PARD6B independently of PARD3 to regulate epithelial cell polarity. Plays a role in microtubule dynamics in the early secretory pathway through interaction with RAB2A and GAPDH and recruitment to vesicular tubular clusters (VTCs). In human coronary artery endothelial cells (HCAEC), is activated by saturated fatty acids and mediates lipid-induced apoptosis.confidentP41743
Protein kinase C iota type Calcium- and diacylglycerol-independent serine/ threonine-protein kinase that plays a general protective role against apoptotic stimuli, is involved in NF-kappa-B activation, cell survival, differentiation and polarity, and contributes to the regulation of microtubule dynamics in the early secretory pathway. Is necessary for BCR-ABL oncogene-mediated resistance to apoptotic drug in leukemia cells, protecting leukemia cells against drug-induced apoptosis. In cultured neurons, prevents amyloid beta protein-induced apoptosis by interrupting cell death process at a very early step. In glioblastoma cells, may function downstream of phosphatidylinositol 3-kinase (PI(3)K) and PDPK1 in the promotion of cell survival by phosphorylating and inhibiting the pro-apoptotic factor BAD. Can form a protein complex in non-small cell lung cancer (NSCLC) cells with PARD6A and ECT2 and regulate ECT2 oncogenic activity by phosphorylation, which in turn promotes transformed growth and invasion. In response to nerve growth factor (NGF), acts downstream of SRC to phosphorylate and activate IRAK1, allowing the subsequent activation of NF-kappa-B and neuronal cell survival. Functions in the organization of the apical domain in epithelial cells by phosphorylating EZR. This step is crucial for activation and normal distribution of EZR at the early stages of intestinal epithelial cell differentiation. Forms a protein complex with LLGL1 and PARD6B independently of PARD3 to regulate epithelial cell polarity. Plays a role in microtubule dynamics in the early secretory pathway through interaction with RAB2A and GAPDH and recruitment to vesicular tubular clusters (VTCs). In human coronary artery endothelial cells (HCAEC), is activated by saturated fatty acids and mediates lipid-induced apoptosis.confidentQ5R4K9
Protein kinase C iota type Calcium- and diacylglycerol-independent serine/ threonine-protein kinase that plays a general protective role against apoptotic stimuli, is involved in NF-kappa-B activation, cell survival, differentiation and polarity, and contributes to the regulation of microtubule dynamics in the early secretory pathway. Is necessary for BCR-ABL oncogene-mediated resistance to apoptotic drug in leukemia cells, protecting leukemia cells against drug-induced apoptosis. In cultured neurons, prevents amyloid beta protein-induced apoptosis by interrupting cell death process at a very early step. In glioblastoma cells, may function downstream of phosphatidylinositol 3-kinase (PI3K) and PDPK1 in the promotion of cell survival by phosphorylating and inhibiting the pro-apoptotic factor BAD. Can form a protein complex in non-small cell lung cancer (NSCLC) cells with PARD6A and ECT2 and regulate ECT2 oncogenic activity by phosphorylation, which in turn promotes transformed growth and invasion. In response to nerve growth factor (NGF), acts downstream of SRC to phosphorylate and activate IRAK1, allowing the subsequent activation of NF-kappa-B and neuronal cell survival. Functions in the organization of the apical domain in epithelial cells by phosphorylating EZR. This step is crucial for activation and normal distribution of EZR at the early stages of intestinal epithelial cell differentiation. Forms a protein complex with LLGL1 and PARD6B independently of PARD3 to regulate epithelial cell polarity. Plays a role in microtubule dynamics in the early secretory pathway through interaction with RAB2A and GAPDH and recruitment to vesicular tubular clusters (VTCs). In human coronary artery endothelial cells (HCAEC), is activated by saturated fatty acids and mediates lipid-induced apoptosis. Downstream of PI3K is required for insulin-stimulated glucose transport. Activates RAB4A and promotes its associtation with KIF3A which is required for the insulin-induced SLC2A4/GLUT4 translocation in adipocytes. Is essential in early embryogenesis and development of differentiating photoreceptors by playing a role in the establishment of epithelial and neuronal polarity.confidentF1M7Y5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031252 [CC]cell leading edgeprobableGO:0005575, GO:0044464, GO:0005623
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0050877 [BP]neurological system processprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707, GO:0003008
GO:0005915 [CC]zonula adherensprobableGO:0070161, GO:0005575, GO:0005913, GO:0005912, GO:0005911, GO:0043296, GO:0030054
GO:0045216 [BP]cell-cell junction organizationprobableGO:0034330, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0043524 [BP]negative regulation of neuron apoptotic processprobableGO:0010941, GO:0060548, GO:0043066, GO:0050794, GO:0008150, GO:0043067, GO:0043523, GO:0065007, GO:0048523, GO:0048519, GO:1901214, GO:1901215, GO:0042981, GO:0050789, GO:0043069
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0031346 [BP]positive regulation of cell projection organizationprobableGO:0051130, GO:0051128, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0031344, GO:0048522
GO:0005543 [MF]phospholipid bindingprobableGO:0043168, GO:0043167, GO:0003674, GO:0008289, GO:0005488
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005923 [CC]tight junctionprobableGO:0005575, GO:0070160, GO:0043296, GO:0030054, GO:0005911
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0051092 [BP]positive regulation of NF-kappaB transcription factor activityprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044093, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0051091, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:0050769 [BP]positive regulation of neurogenesisprobableGO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0008150, GO:0065007, GO:0010720, GO:0048518, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0051960, GO:2000026, GO:0048731, GO:0048522
GO:0043220 [CC]Schmidt-Lanterman incisureprobableGO:0005575, GO:0043209, GO:0043218, GO:0044464, GO:0005623
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0046667 [BP]compound eye retinal cell programmed cell deathprobableGO:0032502, GO:0030154, GO:0048468, GO:0010623, GO:0007569, GO:0009653, GO:0007275, GO:0044699, GO:0001745, GO:0048869, GO:0048513, GO:0010259, GO:0048749, GO:0009887, GO:0032501, GO:0048592, GO:0009987, GO:0044767, GO:0012501, GO:0001654, GO:0048731, GO:0046666, GO:0044707, GO:0007423, GO:0048856, GO:0044763, GO:0008150
GO:0043434 [BP]response to peptide hormone stimulusprobableGO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0010033
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0022607 [BP]cellular component assemblyprobableGO:0044085, GO:0008150, GO:0071840, GO:0016043
GO:0019904 [MF]protein domain specific bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0016477 [BP]cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0044448 [CC]cell cortex partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0034613 [BP]cellular protein localizationprobableGO:0008104, GO:0070727, GO:0009987, GO:0044763, GO:0008150, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0051640 [BP]organelle localizationprobableGO:0009987, GO:0008150, GO:0044763, GO:0051179, GO:0044699, GO:0051641
GO:0048194 [BP]Golgi vesicle buddingprobableGO:0006996, GO:0009987, GO:0016192, GO:0046907, GO:0048193, GO:0016044, GO:0071840, GO:0006810, GO:0006900, GO:0016050, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0000226 [BP]microtubule cytoskeleton organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0016327 [CC]apicolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0035088 [BP]establishment or maintenance of apical/basal cell polarityprobableGO:0061245, GO:0009987, GO:0007163, GO:0008150, GO:0044763, GO:0044699
GO:0031226 [CC]intrinsic to plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030010 [BP]establishment of cell polarityprobableGO:0008150, GO:0009987, GO:0007163, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VD2, chain A
Confidence level:very confident
Coverage over the Query: 2-76
View the alignment between query and template
View the model in PyMOL