Diaphorina citri psyllid: psy5178

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MCESLRICTSRLSCCSQEHEISVHNVIRQSYDKHLRQTLYSLSSILKSRAHRFDALSTMCGHSFRELRRSLPGFFKELLSTSKKSFHDMFKRTYGIIYEQNSFLFTDLFEELEKYFSRGNVDLIEVMDNFFSTLYQKMFTVLNAQYTFDDKISTLYQKIFTVLNAQYTFDDNPRQLGSPMEAHGGEPQLLNCKSDSSKSFTIRFGVKNPMGSTIHILTC
ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHcccccccEEEEEECcccccccccccc
*CESLRICTSRLSCCSQEHEISVHNVIRQSYDKHLRQTLYSLSSILKSRAHRFDALSTMCGHSFRELRRSLPGFFKELLSTSKKSFHDMFKRTYGIIYEQNSFLFTDLFEELEKYFSRGNVDLIEVMDNFFSTLYQKMFTVLNAQYTFDDKISTLYQKIFTVLNAQYTFDDNPRQLGSPMEAHGGEPQLLNCKSDSSKSFTIRFGVKNPMGSTIHILTC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCESLRICTSRLSCCSQEHEISVHNVIRQSYDKHLRQTLYSLSSILKSRAHRFDALSTMCGHSFRELRRSLPGFFKELLSTSKKSFHDMFKRTYGIIYEQNSFLFTDLFEELEKYFSRGNVDLIEVMDNFFSTLYQKMFTVLNAQYTFDDKISTLYQKIFTVLNAQYTFDDNPRQLGSPMEAHGGEPQLLNCKSDSSKSFTIRFGVKNPMGSTIHILTC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0065007 [BP]biological regulationprobableGO:0008150
GO:0017147 [MF]Wnt-protein bindingprobableGO:0003674, GO:0005488, GO:0005515

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ODN, chain A
Confidence level:very confident
Coverage over the Query: 13-54,73-217
View the alignment between query and template
View the model in PyMOL