Diaphorina citri psyllid: psy518


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MTTVISPSVELSSYRDQHFKGSRAEQEKLLRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKRIIMGLDKYKKTPCGFCFLE
ccccccccccccccccccccccHHHHHHHHccccEEEEEcccccccHHHHHHHHHccccccEEEEEccccccccccEEEEc
****************************LLRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKRIIMGLDKYKKTPCGFCFLE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTVISPSVELSSYRDQHFKGSRAEQEKLLRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKRIIMGLDKYKKTPCGFCFLE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear cap-binding protein subunit 2 Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing, translation regulation, nonsense-mediated mRNA decay, RNA-mediated gene silencing (RNAi) by microRNAs (miRNAs) and mRNA export. The CBC complex is involved in mRNA export from the nucleus, leading to the recruitment of the mRNA export machinery to the 5' end of mRNA and to mRNA export in a 5' to 3' direction through the nuclear pore. The CBC complex is also involved in mediating U snRNA and intronless mRNAs export from the nucleus. The CBC complex is essential for a pioneer round of mRNA translation, before steady state translation when the CBC complex is replaced by cytoplasmic cap-binding protein eIF4E. The pioneer round of mRNA translation mediated by the CBC complex plays a central role in nonsense-mediated mRNA decay (NMD), NMD only taking place in mRNAs bound to the CBC complex, but not on eIF4E-bound mRNAs. The CBC complex enhances NMD in mRNAs containing at least one exon-junction complex (EJC), promoting the interaction between upf1 and upf2. The CBC complex is also involved in 'failsafe' NMD, which is independent of the EJC complex, while it does not participate in Staufen-mediated mRNA decay (SMD). During cell proliferation, the CBC complex is also involved in microRNAs (miRNAs) biogenesis via its interaction with srrt/ars2, thereby being required for miRNA-mediated RNA interference. The CBC complex also acts as a negative regulator of parn, thereby acting as an inhibitor of mRNA deadenylation. In the CBC complex, ncbp2/cbp20 recognizes and binds capped RNAs (m7GpppG-capped RNA) but requires ncbp1/cbp80 to stabilize the movement of its N-terminal loop and lock the CBC into a high affinity cap-binding state with the cap structure.confidentQ6DES0
Nuclear cap-binding protein subunit 2 Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing, translation regulation, nonsense-mediated mRNA decay, RNA-mediated gene silencing (RNAi) by microRNAs (miRNAs) and mRNA export. The CBC complex is involved in mRNA export from the nucleus, leading to the recruitment of the mRNA export machinery to the 5' end of mRNA and to mRNA export in a 5' to 3' direction through the nuclear pore. The CBC complex is also involved in mediating U snRNA and intronless mRNAs export from the nucleus. The CBC complex is essential for a pioneer round of mRNA translation, before steady state translation when the CBC complex is replaced by cytoplasmic cap-binding protein eIF4E. The pioneer round of mRNA translation mediated by the CBC complex plays a central role in nonsense-mediated mRNA decay (NMD), NMD only taking place in mRNAs bound to the CBC complex, but not on eIF4E-bound mRNAs. The CBC complex enhances NMD in mRNAs containing at least one exon-junction complex (EJC), promoting the interaction between UPF1 and UPF2. The CBC complex is also involved in 'failsafe' NMD, which is independent of the EJC complex, while it does not participate in Staufen-mediated mRNA decay (SMD). During cell proliferation, the CBC complex is also involved in microRNAs (miRNAs) biogenesis via its interaction with SRRT/ARS2, thereby being required for miRNA-mediated RNA interference. The CBC complex also acts as a negative regulator of PARN, thereby acting as an inhibitor of mRNA deadenylation. In the CBC complex, NCBP2/CBP20 recognizes and binds capped RNAs (m7GpppG-capped RNA) but requires NCBP1/CBP80 to stabilize the movement of its N-terminal loop and lock the CBC into a high affinity cap-binding state with the cap structure.confidentQ5ZKR5
Nuclear cap-binding protein subunit 2 Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing and RNA-mediated gene silencing (RNAi). The CBC complex is involved in miRNA-mediated RNA interference and is required for primary microRNAs (miRNAs) processing. Also involved in innate immunity via the short interfering RNAs (siRNAs) processing machinery by restricting the viral RNA production. In the CBC complex, Cbp20 recognizes and binds capped RNAs (m7GpppG-capped RNA) but requires Cbp80 to stabilize the movement of its N-terminal loop and lock the CBC into a high affinity cap-binding state with the cap structure.confidentQ7QCB6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044428 [CC]nuclear partconfidentGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0032991 [CC]macromolecular complexconfidentGO:0005575
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0000243 [CC]commitment complexprobableGO:0005575, GO:0005622, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005684, GO:0043227, GO:0043226, GO:0005681
GO:0046833 [BP]positive regulation of RNA export from nucleusprobableGO:0032388, GO:0060341, GO:0051050, GO:0032239, GO:0032386, GO:0050794, GO:0032241, GO:0046824, GO:0065007, GO:0046831, GO:0008150, GO:0051049, GO:0048518, GO:0046822, GO:0032879, GO:0050789
GO:0000340 [MF]RNA 7-methylguanosine cap bindingprobableGO:0000339, GO:0003674, GO:0005488, GO:0003676, GO:0097159, GO:1901363, GO:0003723
GO:0006446 [BP]regulation of translational initiationprobableGO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0006417, GO:0008150, GO:0010468
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005845 [CC]mRNA cap binding complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0034518, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045292 [BP]mRNA cis splicing, via spliceosomeprobableGO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0006396, GO:0006397
GO:0006408 [BP]snRNA export from nucleusprobableGO:0015931, GO:0051169, GO:0051168, GO:0051641, GO:0044699, GO:0071705, GO:0071702, GO:0033036, GO:0006405, GO:0009987, GO:0006810, GO:0006913, GO:0051030, GO:0044765, GO:0008150, GO:0051649, GO:0051236, GO:0051234, GO:0051179, GO:0016482, GO:0050658, GO:0006403, GO:0046907, GO:0050657, GO:0044763
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0006370 [BP]7-methylguanosine mRNA cappingprobableGO:0036260, GO:0009452, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0044238, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0008143 [MF]poly(A) RNA bindingprobableGO:0005488, GO:0097159, GO:0070717, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:1901363, GO:0003729
GO:0050434 [BP]positive regulation of viral transcriptionprobableGO:0009893, GO:0019222, GO:0031328, GO:2000243, GO:0031325, GO:2000241, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:0019219, GO:0065007, GO:0046782, GO:0031326, GO:0048518, GO:0045935, GO:0060255, GO:0050792, GO:0009889, GO:0050794, GO:0043902, GO:0043900, GO:0008150, GO:0051171, GO:2001141, GO:0051173, GO:0051252, GO:0051254, GO:0010557, GO:0010556, GO:0048524, GO:0048522
GO:0045071 [BP]negative regulation of viral genome replicationprobableGO:2000242, GO:0050792, GO:0045069, GO:2000241, GO:0050794, GO:0008150, GO:0043900, GO:0043901, GO:0065007, GO:0048525, GO:0048519, GO:0050789, GO:0048523
GO:0035195 [BP]gene silencing by miRNAprobableGO:0010605, GO:0019222, GO:0035194, GO:0010608, GO:0009987, GO:0040029, GO:0050789, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0044763, GO:0031047, GO:0010629, GO:0048519, GO:0016441, GO:0009892, GO:0010468, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0034660 [BP]ncRNA metabolic processprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0006369 [BP]termination of RNA polymerase II transcriptionprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006353, GO:0019438
GO:0006368 [BP]transcription elongation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006354, GO:0006351, GO:0019438
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0031124 [BP]mRNA 3'-end processingprobableGO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:1901360, GO:0009987, GO:0006725, GO:0034641, GO:0031123, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:0044237, GO:0008152, GO:0046483, GO:0006396, GO:0006397
GO:0000387 [BP]spliceosomal snRNP assemblyprobableGO:0022607, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:0034622, GO:0071840, GO:0006139, GO:0071826, GO:0044260, GO:0016043, GO:0065003, GO:0071704, GO:0010467, GO:0022618, GO:1901360, GO:0022613, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0044085, GO:0006396, GO:0006397
GO:0030422 [BP]production of siRNA involved in RNA interferenceprobableGO:0009892, GO:0019222, GO:0090304, GO:0031050, GO:0010629, GO:0006807, GO:0070887, GO:0050789, GO:0044699, GO:0070918, GO:0006139, GO:0051716, GO:0010605, GO:0044260, GO:0071359, GO:0010608, GO:1901360, GO:0040029, GO:0071704, GO:0010467, GO:0065007, GO:0014070, GO:0016246, GO:0010468, GO:0060255, GO:0009987, GO:0006725, GO:0071310, GO:0044763, GO:0031047, GO:0008152, GO:0048519, GO:0042221, GO:0010033, GO:0046483, GO:0016070, GO:0044238, GO:0016458, GO:0035194, GO:0071407, GO:1901698, GO:1901699, GO:0034641, GO:0044237, GO:0043170, GO:0043331, GO:0016441, GO:0008150, GO:0050896, GO:0006396
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005846 [CC]nuclear cap binding complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0034518, GO:0044424
GO:0008334 [BP]histone mRNA metabolic processprobableGO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0000184 [BP]nuclear-transcribed mRNA catabolic process, nonsense-mediated decayprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439
GO:0006406 [BP]mRNA export from nucleusprobableGO:0015931, GO:0051169, GO:0051168, GO:0016482, GO:0051028, GO:0044699, GO:0071705, GO:0071702, GO:0033036, GO:0006405, GO:0009987, GO:0006810, GO:0006913, GO:0044763, GO:0051649, GO:0051236, GO:0051234, GO:0051179, GO:0051641, GO:0050658, GO:0006403, GO:0046907, GO:0050657, GO:0008150
GO:0016032 [BP]viral reproductionprobableGO:0009987, GO:0044764, GO:0008150, GO:0051704

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1H2V, chain Z
Confidence level:very confident
Coverage over the Query: 27-81
View the alignment between query and template
View the model in PyMOL